SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023679 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023679
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily SNF-like 9.02e-39
Family SNF-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023679   Gene: ENSOCUG00000023311   Transcript: ENSOCUT00000021249
Sequence length 198
Comment pep:novel scaffold:OryCun2.0:AAGW02083382:1:5257:1 gene:ENSOCUG00000023311 transcript:ENSOCUT00000021249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YAIGLGNVRSFPYPCRKNGVGASLVPYFLTLIFAGVLLFLLECSLGQYMSIGGLGIWKLA
PMFKGVKPGLWPVLSFWLNITYIGIISWAIYYLYNSFTTTSHCWKQCDNPWNTDRCFSNY
SIVNTTTMTSTMVEFWEHNMHQMTDGLDKPGQRWLLAITLAIAWVLVYYCIWKGVGWTGK
VRAWGCQGSSAQARGPQL
Download sequence
Identical sequences G1U2S6
ENSOCUP00000023679 ENSOCUP00000023679 9986.ENSOCUP00000023679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]