SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023690 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023690
Domain Number 1 Region: 6-198
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 3.66e-60
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023690   Gene: ENSOCUG00000025762   Transcript: ENSOCUT00000029570
Sequence length 209
Comment pep:known_by_projection scaffold:OryCun2.0:GL019625:7042:20625:-1 gene:ENSOCUG00000025762 transcript:ENSOCUT00000029570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYKTVQRLIPA
LWEKHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNRHFCPGSQCCVEDGPESIDSVI
DMDAVCERLTELGLDVTVTISQDAGRYLCDFTYYTSLYQGHGRSAFVHVPPLGKPYNADQ
LGRALRVIIAEMLGVLEQSDRQGSCCRQR
Download sequence
Identical sequences G1U2T7
ENSOCUP00000023690 XP_002724291.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]