SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024440 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024440
Domain Number 1 Region: 1817-2062
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 1173-1315
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000118
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 402-525
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000204
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 584-713
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000256
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 871-997
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000675
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number 6 Region: 521-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000038
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 7 Region: 250-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000121
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 991-1105
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000565
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 9 Region: 1144-1187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family EGF-type module 0.014
Further Details:      
 
Domain Number 10 Region: 81-220
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000119
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 11 Region: 213-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 12 Region: 288-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 13 Region: 1506-1537
Classification Level Classification E-value
Superfamily Notch domain 0.000000106
Family Notch domain 0.0035
Further Details:      
 
Domain Number 14 Region: 325-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000139
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 15 Region: 56-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000322
Family EGF-type module 0.038
Further Details:      
 
Domain Number 16 Region: 367-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000322
Family EGF-type module 0.017
Further Details:      
 
Domain Number 17 Region: 748-782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000982
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 18 Region: 705-747
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000167
Family EGF-type module 0.01
Further Details:      
 
Domain Number 19 Region: 1465-1497
Classification Level Classification E-value
Superfamily Notch domain 0.00000222
Family Notch domain 0.0049
Further Details:      
 
Domain Number 20 Region: 1112-1152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000822
Family EGF-type module 0.051
Further Details:      
 
Domain Number 21 Region: 1433-1457
Classification Level Classification E-value
Superfamily Notch domain 0.0000131
Family Notch domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000024440
Domain Number - Region: 834-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000214
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 1313-1343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00132
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024440   Gene: ENSOCUG00000022014   Transcript: ENSOCUT00000028937
Sequence length 2362
Comment pep:known_by_projection scaffold:OryCun2.0:GL018829:703871:728340:1 gene:ENSOCUG00000022014 transcript:ENSOCUT00000028937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLPTPTGTPPAHCSCCLVEGWRGSAAGCRGGVLGTLLTPTSPPFLRLSPPAAPPCLDG
SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGVARFSC
RCPRGFRGPDCSLPDPCLSSPCAHGARCSVGSDGRFVCSCPPGYQGRSCRSDVDECRVGG
PCRHGGTCLNTPGSFRCQCPGGYTGLLCEIPAVPCAPSPCRNGGTCRQSGDLTYDCACLP
GFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACH
NGGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTG
LLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLG
RCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTFC
EVDIDECQSSPCVNGGVCRDRVNGFSCTCPSGFSGATCQLDVDECASTPCRNGAKCVDQP
DGYECHCAEGFEGTLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDEC
RSQPCRHGGKCLDLVDKYLCRCPPGTTGLNCEVNIDDCASNPCTFGVCRDGINRYDCVCQ
PGFTGPLCNVEINECASNPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPTHPCAHEPCSH
GICHDAPGGFRCVCEPGWSGPRCSQSLNRDACESQPCRAGGTCTSDGSGFRCTCPPGVQG
VSVSLFPPQAPTALSSSPLDTGLCFAFSLSPQELGGWTTSFHLPHTGRQCELLSPCTPNP
CEHGGHCESGPGQMPVCSCSAGWQGTRPRCQQDVDECAGGPSPCGPHGTCTNLMGSFSCT
CHGGYTGPSCDQDINDCDPNPCLNGGSCQDGTGSFSCSCLPGFTGPHCARDVDECLSSPC
GPGTCTDHVASFTCTCPPGYGGLHCEKDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTG
AHCQHEADPCLSRPCLHGGVCSAAHPSFRCTCPEGFTGSQCQTPVDWCSHGLCQNEGRCV
QTGAYCLCPPGWSGRFCDVRSLPCKEAAAQMGVPLDQLCQGGGQCVSEDNSHFCLCPEGR
TGSHCEQEVDPCGAQPCQHGATCRGYMGGYVCECPAGYTGDKCQDDVDECASQPCQHGGS
CIDLVARYLCSCPPGTLGVLCEIDEDDCGPGPPSDAAGPRCLHNGTCVDLVGGFRCSCPP
GYTGLHCEADINECRPGACHAAHTRDCLQDPGGHFHCLCHPGFTGPRCQTVLSPCESQPC
QHGGQCRPGPGPGGGLSFTCHCLQVGGAYPENGAGGGPPRPGLDPTSLSFSPHPPSISLS
PVPDCPPCLNRGALYRAPPPLAPFFFPGAVPPLGWDRAPASREPRCRAPPSQAKRGDQRC
DRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAG
GRERTCKYEKYCADHFADGRCDQGCNTEECGWDGLDCAREVPALLARGVLVLTVLLPPEE
LLRSGADFLQRLSAILRTSLRFRLDARGQAMIFPYHRPGSVASEARARRELAPEVIGSVV
MLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPPEPSLP
LLPLLAAGAVFLLLILVLGVMVARRKREHSTLWFPEGFALHKDVAGGHKGRREPVGQDAL
GMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMGAEEAVDCRQWTQHHLVAADIRV
APAMALTPPQGDADTDGMDVNVRGPDGFTPLMLASFCGGALEPMPTEEDEAEDTSASIIS
DLICQGAQLGARTDRTGETALHLAARYARADAAKRLLDAGADTNAQDHSGRTPLHTAVTA
DAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEGMVEELIASHADVNAVDELGKSA
LHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAAREGSYEAAKLLLDHFANREITD
HLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLGPLLCPPGAFLPGLKATQSGAKK
SRRPPGKAGLGAQGARGRGKKLTLACPGPLAESSVTLSPVDSLDSPRPFGGPPASPGAFP
LEGPYAAAAATAVSLAQLGGAGRAGPLGRQPPGGCVLSLGLLNPVAVPLDWARLPPPAPP
GPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAAPGHGEEYPAPGAHGSPPKARFLRVPSE
HPYLTPSPESPEQWASPSPPSLSDWSESTPSPATAAGATATATAAGALPAQPHPLSVPGS
LAQAQTQLGPQPEVTPKRQVLA
Download sequence
Identical sequences G1U4W4
ENSOCUP00000024440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]