SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024710 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024710
Domain Number 1 Region: 206-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000803
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 5-33
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000549
Family KRAB domain (Kruppel-associated box) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024710   Gene: ENSOCUG00000027897   Transcript: ENSOCUT00000030804
Sequence length 328
Comment pep:novel scaffold:OryCun2.0:GL018844:443177:444836:-1 gene:ENSOCUG00000027897 transcript:ENSOCUT00000030804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRASPFKDMILCFSEEDWPLLNPGQTGFYGEFIIGEDCGISVTPRVPAHHTPPPLHSASW
TLSLAVRATLGATQWGALPSPGADDPAALLGPFQGEESELLLELLELQGKEAPQEAPTWI
RQFLCAQGLHCWGWEVSTLGTACVGYSASAPPVKETKVPPRTWAWVPRPACKGCEASSHA
VVHPTPRIPSWPLKGGPARTEITQEYCKNSWRQTTGPGEHEAHETHEAQKPYRCGSCGRS
FRHNYHLLSHQRIHRQPNRLEPEMQSVEGLGFQRQEPLAQHCSHTHQKDTIRPFQQCYCI
KSFGQNLDIFCHECVHMKRCSKQALNSY
Download sequence
Identical sequences G1U5M8
9986.ENSOCUP00000024710 ENSOCUP00000024710 ENSOCUP00000024710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]