SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025081 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025081
Domain Number 1 Region: 24-325,402-438
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-45
Family FAD-linked reductases, N-terminal domain 0.00053
Further Details:      
 
Domain Number 2 Region: 310-412
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.2e-18
Family L-aminoacid/polyamine oxidase 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025081   Gene: ENSOCUG00000022016   Transcript: ENSOCUT00000030096
Sequence length 438
Comment pep:novel scaffold:OryCun2.0:GL019045:134654:138285:1 gene:ENSOCUG00000022016 transcript:ENSOCUT00000030096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCFEDPQYEELVQLARDGLGTTAERKRIVVIGAGIARLTVAKTLQEAGHQVTVLEASGRV
GGRVKTHRVPGAPWHVELGAMRIPVSHRLALGLVRKLGLPLQEFWPRNSQTWVLVNSVRQ
RLVHVQADPGPLGYPVRAEKGKTAEQLFLQSLWKVAEELKTSSCEHSLPGLSLHLAAGVP
VHRGDLSLGAMQMIEDLLEPDSGYHKAFIETMQASISLLYREIAGGFDQLPQALQDTLLP
GTVRLYSPAHEVDTLGGRVHVTLGTPDPLQPGERLAADFLVVATTAKAARLLCFRPPQSP
AKERSLRQAHYSSATKCFWECITSGMSTTDRPSHFIYCPSHAFSHTSDVLLASFTREEDS
AFFTALDSERILDVVLNDLAAVHACPERELRALCPYGTVKRWSRDPYSMGGITLFTPTGT
QELSQPEGPIYFAGEHTS
Download sequence
Identical sequences G1U6N4
9986.ENSOCUP00000025081 ENSOCUP00000025081 ENSOCUP00000025081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]