SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025145 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025145
Domain Number 1 Region: 5-134
Classification Level Classification E-value
Superfamily ApaG-like 1.31e-40
Family ApaG-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025145   Gene: ENSOCUG00000026650   Transcript: ENSOCUT00000026135
Sequence length 139
Comment pep:novel chromosome:OryCun2.0:1:173081668:173093569:-1 gene:ENSOCUG00000026650 transcript:ENSOCUT00000026135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECVATTGDITVSVSTSFLPELSSVHPPHYFFTYRIRWIEMSKDALPEKACQLDSRYWRIT
NAKGDVEEVQGPGVVGEFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNV
AIPRFHMACPTFRVSVARL
Download sequence
Identical sequences G1U6U7
ENSOCUP00000025145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]