SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025903 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025903
Domain Number 1 Region: 546-592
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 2 Region: 123-155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000126
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 63-111
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000615
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000025903
Domain Number - Region: 501-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025903   Gene: ENSOCUG00000017190   Transcript: ENSOCUT00000024304
Sequence length 592
Comment pep:known_by_projection chromosome:OryCun2.0:13:109907255:109953450:1 gene:ENSOCUG00000017190 transcript:ENSOCUT00000024304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKSWTWTWRVPAELLLLCAALGCLCVPGSRSERPRSLEPTVVNRSLAKSRHSRSVDATP
MPIDCELSSWSSWTMCDPCQKKRYRHAYLLRPSQFNGEPCNFSDKEVEDCATSRPCRSQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRKIYKKCHHEMEQYWAIGSLASGIN
LFTNSLEGPVLDHRYYAGGCNPHYILDMRFRKPYNVESYTPQTQGKYKFALAEYESYSDF
ERNVMEKTYSKSTFNLGFKIPSIFEFGINTESDQLMNYISRTKRFSHTKSKFLHARSALE
VAHYKLKPRNLMLHYRLDQESKHFSLEHSENPQGVFRGGWKERAKSIVKHRKMDGVSSLL
AHGHVSLPLSDYSLNDVQACAKNDFKLGAAIEEVYVSLGVSTSKCRGILNEIKDRNKRDT
MVQDLVVLVRGGASEHITALAYSDLPTADLMQEWGDAVQYNPAIIKIKVEPLYELVTATD
VAYSSTVKQNMRQALEEFQGEVSPCRCAPCQGNGVPVQKGSRCDCICPVGFQGSACEITS
RKNVPIDGRWSCWSRWSSCSGGQKTRRRQCNNPAPQDGGSPCSGPASETLAC
Download sequence
Identical sequences G1U8Y5
9986.ENSOCUP00000025903 ENSOCUP00000025903 ENSOCUP00000014773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]