SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026076 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026076
Domain Number 1 Region: 1-45
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000327
Family Elafin-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026076   Gene: ENSOCUG00000029033   Transcript: ENSOCUT00000032983
Sequence length 45
Comment pep:known_by_projection scaffold:OryCun2.0:GL018725:426470:426604:-1 gene:ENSOCUG00000029033 transcript:ENSOCUT00000032983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPGNCPLVEFQCLMLNPPNLCETDSQCKDNLKCCQGSCGKACFLP
Download sequence
Identical sequences G1U9F5
ENSOCUP00000026076 ENSOCUP00000026076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]