SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026390 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026390
Domain Number 1 Region: 18-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-27
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 226-343
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000262
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 429-466
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 4 Region: 139-176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 185-224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000107
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 390-427
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000026390
Domain Number - Region: 362-389
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00327
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026390   Gene: ENSOCUG00000009440   Transcript: ENSOCUT00000033342
Sequence length 742
Comment pep:known_by_projection chromosome:OryCun2.0:5:3132036:3137547:1 gene:ENSOCUG00000009440 transcript:ENSOCUT00000033342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGGAAISQPPLLTAACSGKLEQHTERRGVIYSPAWPLNYPAGTNCSWYIQGDRGDMIT
ISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASS
SGQAQGFRLSYIRGKLGQTSCQADEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPAS
EPPGSLCPGGTFPCSGARSTRCLPVERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSF
ASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTL
SYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGGSGEGDGGD
TGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYAPADRCNNQKSCPD
GADEKNCFSCQPGTFHCATNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGS
LVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPV
EDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRLGRLWNRLFHRPRAPRGQIPLL
TAARTSQTVLGDGLVQPAPGAAPAPRTDTGSPRAASDGAPSAPGHAPEGGPPGPVPASSL
RDPECRPVDKDRKARRDPPVDSSAPADTPREPCSAQDPQPQAPTASSTLGSHPPEPLGVC
RSPPPPCSPTSEASDDEALLVC
Download sequence
Identical sequences U3KMD2
ENSOCUP00000026390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]