SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026577 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026577
Domain Number 1 Region: 162-292
Classification Level Classification E-value
Superfamily HIT-like 8.97e-49
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.011
Further Details:      
 
Domain Number 2 Region: 1-102
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.97e-34
Family FHA domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026577   Gene: ENSOCUG00000000738   Transcript: ENSOCUT00000033531
Sequence length 294
Comment pep:novel chromosome:OryCun2.0:1:20417696:20450696:1 gene:ENSOCUG00000000738 transcript:ENSOCUT00000033531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVCWLVRQDSQHQRIKLPHLEAVVIGRSPETKITDKKCSRQQVQLKAECNKGYVKVKQV
GVNPTSIDSVIIGKDQEMKLYPGQVLCMVNELYPYIVEFEEEAKSSGLETHRKRKRSGNN
DSVERDAAQEAEPGTGLGPGSSPSHCPVPPKKGKDASTNKEPLGHWSQGLKISMQDPKMQ
VYKDEQVVVIKDKYPKARYHWLVLPWASISSLKAVTREHLELLKHMHTVGEKVIADFGSS
KLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEYFLESQGNSVL
Download sequence
Identical sequences U3KMW8
ENSOCUP00000026577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]