SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026733 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026733
Domain Number 1 Region: 22-57
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026733   Gene: ENSOCUG00000005605   Transcript: ENSOCUT00000033686
Sequence length 316
Comment pep:known_by_projection chromosome:OryCun2.0:9:48469156:48669694:-1 gene:ENSOCUG00000005605 transcript:ENSOCUT00000033686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLKLVQDWGETSRRPQYPGRECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVT
EHPPPGIFNSELEFAQVIIIVVVVTVMVVVIVCLLNHYKVSTRSFINRPSQSRRQEDGLQ
PEGCLWPSDSTVPRPGTSEIMYAPRARDRFTAPAFIQRDRFSRFQPTYPYVQHEIDLPPT
ISLSDGEEPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRTIFDSDLIDISMYNGGPCPP
SSNSGISATTCSSHGRLEGPPPPYSEVVGRCPGASFFHHQHGSNTHRGSRLQFVQNNPES
TVVPTKGKDRKPGNLV
Download sequence
Identical sequences U3KNC4
ENSOCUP00000026733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]