SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026775 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026775
Domain Number 1 Region: 22-358
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.22e-107
Family Phosphofructokinase 0.000000302
Further Details:      
 
Domain Number 2 Region: 561-789
Classification Level Classification E-value
Superfamily Phosphofructokinase 8.11e-57
Family Phosphofructokinase 0.00012
Further Details:      
 
Domain Number 3 Region: 349-562
Classification Level Classification E-value
Superfamily Phosphofructokinase 5.76e-56
Family Phosphofructokinase 0.0000633
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026775   Gene: ENSOCUG00000011039   Transcript: ENSOCUT00000033728
Sequence length 841
Comment pep:known scaffold:OryCun2.0:GL018707:2754507:2837415:1 gene:ENSOCUG00000011039 transcript:ENSOCUT00000033728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNKVSASPRGSYRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIVEANWESVSSILQVGGTIIGSARCKAFRTREGRLKAACNLIHRGIT
NLCVIGGDGSLTGANIFRMEWSGLLEELAQDGKIDNEAVQKYAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVIDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRAQKKRLNIIIVAEGAIDTLNRPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEATPETPACVVSLSGNHAVRLPLVEC
VQMTQEVQKAMDERRFKDAVQLRGRSFENNLNTYKRLAIKLPDDKIQKSNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHKMFAVYDGFDGFAKGQIKEIRWGDVGGWTGQGGSILGTK
RILPGKYLEEIATQIRTHNINAILIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDAYHSMLILGEARTRHEEFCIPMCVVPATISNNVPGSDLS
IGCDTGLNMVVETCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEEP
FDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGRGVFDCRKNVL
GHMQQGGAPSPFDRNFGTKISARAMQWITTKLKESPGKGKRFVSDDSICVLGISKRNVLF
QPVAELKNETDFECIMSGRFRSRQRDEKRTPYIMKEKKKTILLMVQFKSRKKHHILDTLQ
P
Download sequence
Identical sequences U3KNG6
ENSOCUP00000026775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]