SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026826 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026826
Domain Number 1 Region: 80-290,327-371
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.71e-53
Family Class II glutamine amidotransferases 0.000015
Further Details:      
 
Domain Number 2 Region: 378-502
Classification Level Classification E-value
Superfamily SIS domain 5.56e-23
Family double-SIS domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026826   Gene: ENSOCUG00000029568   Transcript: ENSOCUT00000033778
Sequence length 510
Comment pep:known_by_projection chromosome:OryCun2.0:2:116803910:116856818:1 gene:ENSOCUG00000029568 transcript:ENSOCUT00000033778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAGGGAVRAEGRGPAAVAGRTREVEKPVAASAVASPRESCRRCPGPRAHDRPRSSCLC
ASPRQQLVSCLADRASSIMCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGV
DGGNDKDWEANACKIQLIKKKGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEP
NPVNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDN
RESQDISFTTLVERVIQQLEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHI
PILYRTGKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVA
AVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRG
RVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELAS
DFLDRNTPVFRDDVCFFISQSGVLIFFKNF
Download sequence
Identical sequences U3KNL7
ENSOCUP00000026826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]