SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026953 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026953
Domain Number 1 Region: 95-290
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.18e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.00000000534
Further Details:      
 
Domain Number 2 Region: 26-90
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.5e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026953   Gene: ENSOCUG00000009401   Transcript: ENSOCUT00000033905
Sequence length 290
Comment pep:known_by_projection chromosome:OryCun2.0:10:14084016:14119205:1 gene:ENSOCUG00000009401 transcript:ENSOCUT00000033905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLECSRRQTYRATEISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGL
IAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNMQRPMVVDMCI
REIEARGLKSEGIYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRD
LPIPVITYDTYSKFIEAAKVSSADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTLNEK
DNFMNAENLGIVFGPTLMRPPEDNTLTTLHDMRYQKLIVQILIENEDVLF
Download sequence
Identical sequences U3KNZ3
ENSOCUP00000026953 XP_017199896.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]