SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000027169 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000027169
Domain Number 1 Region: 46-150
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-32
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 165-289
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-19
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 3 Region: 287-323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000027169   Gene: ENSOCUG00000007675   Transcript: ENSOCUT00000034120
Sequence length 529
Comment pep:known_by_projection chromosome:OryCun2.0:9:112973916:113139291:-1 gene:ENSOCUG00000007675 transcript:ENSOCUT00000034120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVERGASAVRTDMIHGRSLFPKKQTTSETQKSVQCGTWTKHAEGGIFTSPNYPSKYPP
DRECIYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQQNPP
VIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGVLKPLPACEFEMGGPEGIVE
SMQILKEGKASAGEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGSSSVE
DLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCHSNMC
INNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCIVIILIIISVIVQ
IKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGATADFADVAEDFDNYHKLRRSS
SKCIHDHHCGSQLSSTKGSRSNLSTRDASVLTEMPPQPVKPLIPPMSRRNILVMKHNYSQ
DAADACDIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences U3KPK9
ENSOCUP00000027169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]