SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000072 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000072
Domain Number 1 Region: 172-367
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8e-56
Family Prokaryotic proteases 0.000000983
Further Details:      
 
Domain Number 2 Region: 381-476
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-20
Family HtrA-like serine proteases 0.00078
Further Details:      
 
Domain Number 3 Region: 40-122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000122
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number 4 Region: 107-154
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000892
Family Ovomucoid domain III-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000072   Gene: ENSOCUG00000000083   Transcript: ENSOCUT00000000082
Sequence length 480
Comment pep:known_by_projection scaffold:OryCun2.0:GL018706:4424692:4436394:-1 gene:ENSOCUG00000000083 transcript:ENSOCUT00000000082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPQRLPAGLGPLLWLGLLLLGPGPVPSVEARRSRASMPCPATCEPTRCPPLPTCSAGI
TPVLDRCRCCRVCAAAEGEACGGLWGRPCALGLQCRAERVGGAWQGTCGCPAVGAAMCGS
DGRTYPSLCALRAENRAARLRGALPAVPVQKGSCGDPGTGSAGRLRSKYNFIAAVVEKVA
PAVVHLQLFRRSPLSSKDIPASSGSGFIVSEDGLIVTNAHVLTNQQRIQVELQSGVQYEA
TVKDIDHKLDLALIKIEPNTDLPVLLLGRSSDLRAGEFVVALGSPFSLQDTVTAGIVSTT
QRGGKELGLKDSDMDYIQTDAIINHGNSGGPLVNLDGDVIGINTLKVTAGISFAIPSDRI
RQFLADYHERQLKGKSLLQKKYLGLRMLPLTMNLLQEMKRQDPDFPDVSSGVLVYEVIQG
TAAESSGLRDHDVIVSINGQPVTTTTDVIEAVKDNDSLSVIVHRGRETLLLMVTPEIIKP
Download sequence
Identical sequences G1SCJ7
ENSOCUP00000000072 9986.ENSOCUP00000000072 ENSOCUP00000000072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]