SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000153 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000153
Domain Number 1 Region: 187-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-51
Family DBL homology domain (DH-domain) 0.000000321
Further Details:      
 
Domain Number 2 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.19e-39
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 1.66e-32
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 667-768,817-843
Classification Level Classification E-value
Superfamily SH2 domain 2.99e-27
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 5 Region: 590-697
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000132
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 6 Region: 784-832
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000228
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000153   Gene: ENSOCUG00000000172   Transcript: ENSOCUT00000000172
Sequence length 847
Comment pep:known_by_projection chromosome:OryCun2.0:13:56144498:56550635:1 gene:ENSOCUG00000000172 transcript:ENSOCUT00000000172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWRQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESINDEDIYKGLPDLIDETRVEDEEDLYDCVYGEDEGGEVYEDLMKAE
EAHQPKCPENDIRSCCLAEIKQTEEKYAETLESIEKYFMAPLKRFLTTAEFDSVFINIPE
LVKVHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDHISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTPDPVEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDHADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQ
GYLCFKCGARAHKECLGRVDNCGRVNCGEQGTLKPPEKRTNGLRRTSRQVDPGLPKMQVI
RNYMGTPPPGLHEGPPLHIQAGDTVELLRGDAHSLFWQGRNLASGEVGFFPSDAVKPSPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRT
GNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE
Download sequence
Identical sequences G1SCR8
ENSOCUP00000000153 ENSOCUP00000021833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]