SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000562 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000562
Domain Number 1 Region: 214-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 326-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-24
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 3 Region: 382-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.99e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 270-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 53-103
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-21
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 429-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.09e-19
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 178-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.67e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000562   Gene: ENSOCUG00000000645   Transcript: ENSOCUT00000000646
Sequence length 494
Comment pep:known_by_projection scaffold:OryCun2.0:GL018924:279995:287696:-1 gene:ENSOCUG00000000645 transcript:ENSOCUT00000000646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGRGWEVTSGTRSAPGPNGSFPTPRSDPRSPRVCGRNCEMASHASTSESAAHGSVTFSD
VAIDFSQEEWACLTSAQRDLYWDVMLENYSNLVALNLESTYETKSLTIDNTVYEINFPKV
NSGIKTKSFGPKAVPKLPRVSRERDIHPGSMGHKKRPASAEGTEPQPRQRPRQRESSYAC
KECGKAFSRSYQLTQHQKIHTGEKPYECKDCKKAFRWGNQLTQHQKIHTGEKPYECKDCG
KAFRWGSSLVIHKRIHTGEKPYECKDCGKAFRRGDELTQHQRFHTGEKDYECKDCGKTFS
RVYKLIQHKRIHSGEKPYECKDCGKAFICGSSLIQHKRVHTGEKPYECQECGKAFTRVNY
LTQHQKIHTGEKPHECKECGKAFRWGSSLVKHERIHTGEKPYRCAECGKGFNCGYHLTQH
ERIHTGETPYKCKECGKAFIYGSSLVKHERIHTGEKPYECKECGKAFSHGHQLTQHQKTH
AAKSLHLQGVWGGI
Download sequence
Identical sequences G1SDR7
ENSOCUP00000000562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]