SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001822 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001822
Domain Number 1 Region: 631-810
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-38
Family SPRY domain 0.0000896
Further Details:      
 
Domain Number 2 Region: 13-100
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-27
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 340-425
Classification Level Classification E-value
Superfamily RING/U-box 4.01e-26
Family RING finger domain, C3HC4 0.0043
Further Details:      
 
Domain Number 4 Region: 100-164
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.46e-18
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 5 Region: 428-488
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.83e-16
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000001822
Domain Number - Region: 457-579
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00536
Family Apolipoprotein A-I 0.029
Further Details:      
 
Domain Number - Region: 144-233
Classification Level Classification E-value
Superfamily OmpH-like 0.0196
Family OmpH-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001822   Gene: ENSOCUG00000002114   Transcript: ENSOCUT00000002114
Sequence length 813
Comment pep:known chromosome:OryCun2.0:1:146617940:146653039:1 gene:ENSOCUG00000002114 transcript:ENSOCUT00000002114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGWAGARRVVAAMTSAVLVDIQEEVTCPICLELLTEPLSIDCGHSFCQACIAEDREESVI
NQEWESCCPVCQTSYQPGSLRPNRHLASIVGRVRDVVLGPGKELKVTLCAHHGEKLQLFC
KDDGKLICWLCERSQEHRGHHTFLMEEVAQEYQEMFQESLKKLRKEQQEAEKLKAVLKEK
RASWKNQMEPERQRIQTEFNQLRRILDKEEQRELKKLEEEERKGLSVIAEAEGQLVQQSQ
SLRELILDLERRCQGSTVDLLQDVSDVTKRSEFCTLRKPQALPTKLRSMFRAPNLKKMLR
VFRELTDVQSYWEEQRGSLKRAKGTSETRTGRSRELISMASAILANMKEEVTCPICLELL
VEPLSIDCGHSFCQACITANYESMIAKEMESRCPVCRIGYQLENLRPNRHVANIVEKINE
IKLSSEEGQKQEHCARHGEKLLLFCKEDGKVICWLCERSQEHRGHHTFLMEEVAQEYQEK
LQSALNNLMTKQEEAEKLKAGIQQEITSWKNQLQKERQNIQAEFKHLKDILDSEEQDELQ
KLEEEKGHILKSMEESKHELIQQSQVIQNHISDLENCLQRPTIEMLQDVNDIIYRTETFT
LKKPKTFPEKERKSFQIHELKRTMQMFQDLRHAQRYWVHVTLTPSNNQNIVVSENKRQVI
DDHGFRYGTRQNYFDGILGCPSITSGKHYWEVDVSGKSAWILGVYGPPLLQTTTSFAYEQ
VSKYRPINGYWVIGLQIQYISFEENAISLTPIVPPSRIGVFIDYEAGIVSFFSVTQHKFL
IYKFSACSFSKEVFPYFNPMHCPKPMTICELSC
Download sequence
Identical sequences G1SGU4
ENSOCUP00000001822 ENSOCUP00000001822 9986.ENSOCUP00000001822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]