SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002314 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002314
Domain Number 1 Region: 1310-1387
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 924-997
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000113
Family I set domains 0.031
Further Details:      
 
Domain Number 3 Region: 1210-1287
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000663
Family I set domains 0.03
Further Details:      
 
Domain Number 4 Region: 707-760
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000811
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 419-479
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000602
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 474-534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 570-625
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 8 Region: 1478-1545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000719
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 9 Region: 75-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 816-881
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000034
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 11 Region: 761-820
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000353
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 12 Region: 1427-1484
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000785
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number 13 Region: 1604-1659
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000301
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 14 Region: 341-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000034
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 15 Region: 649-704
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000536
Family TSP-1 type 1 repeat 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002314   Gene: ENSOCUG00000002672   Transcript: ENSOCUT00000002676
Sequence length 1695
Comment pep:known_by_projection scaffold:OryCun2.0:GL018737:100294:510852:1 gene:ENSOCUG00000002672 transcript:ENSOCUT00000002676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAWKNPWWFLVWLALKDATLLQTTAEKSPGAYFLPEFALSPQGSFLEDTTGEQFLTYRY
DDQTSRNTRSDEDKDGNWDAWGDWSDCSRTCGGGASYSLRRCLTGRNCEGQNIRYKTCSN
HDCPPDAEDFRAQQCSAYNDVQYQGRYSEWLPRYNDPAAPCALKCHARGQNLVVELAPKV
LDGTRCNTHSLDMCISGICQAVGCDRQLGSSAKEDNCGVCAGDGATCRLVRGQSKSHVSP
EKREENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEHSFSSPGVFVIENTTVEFQK
GSERQTFKIAGPLMADFIFKTRYTVAKDSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQ
LNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLP
RWEHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCP
KWIAMEWSQCTVTCGRGLRYRVVLCINHRGQHVGGCNPQLKLHIKEECVIPIPCYKPKEK
SPVEAKSPWLKQAQELEETRIVTEEPTFIPEPWSACSTTCGPGVQVREVKCRVLLKFTQT
DTELPEEECEGPELPSERPCFLEACDESPASPALDASLQGKDSEMTYDWEYAGFTPCTAT
CLGGRQEAIAVCVHIQTQRTVNDSLCDLLHRPPAMSQACNTEPCPPRWHMGTWGPCSATC
GVGIQTRDVYCLHPEESPAAPEECREEKPHALQACNQFDCPPSWHIEEWRQCSRTCGGGT
QNRRVTCRQLLTDGSFLNLSDELCPGPKASSHKSCARMDCPPHLAAGNWSQCSVSCGAGT
QRRTQVCQRLTAKGRRVVLSEVMCRGLPGLPLVRACQMPACGKIKAEMKTKLAEQRPQIL
GVQRVYIQTREEKRINLTVGSRAYLLPNTSVIIKCPVRRFQKSLIRWEKDGRCLRNSKRH
GISKSGSLKIHSLAAPDIGVYRCLAGSAQETVVLKLIGTDNRLIAHPALRERVKDFPGVD
RHEANGVGATWHKMWQKWSNKNELSLPDGHIQKQPFLRALLGHCGDSAGDADAWEFKHKQ
FEAAVKQGAYSMDTAQFDELIRNMSQLLETREVSDDLASQVIYQIVAEFAKGQQTHAPWG
GIQEEMPPVAQLRGETGSVPQNLNLKNSGKLTFKPKDPAPARRNHPTSISFNKTINARIG
NTVYITQKTELINILCDLTSASEATYTWTKDGALLQPSAKVIFDGTGKIQIRNPTRKEQG
IYECHVASHLGSDVESSSVLFAEAPVILSIEKNITKPEHSHLSVVVGGLVEAALQANVTI
QCPVKGAPPPNITWLKRGGSLSDNVSLLFNGSLLLQNVSLENEGTYVCTATNALGKAVAT
SVLHLLERRWPGSKTVFPKGHKKRVPQTPYLGTNSSEPTGEPLSQEPFWEAGDWSPCSAT
CGHLGVRVQRPRCVMATGQEASEVRCGHLQKPQGGFQPCNIRDCPARWFASEWSECSVSC
GEGFHSRQVTCKRTRANGTVQVVSPRACASKDRPLGRKPCTGHPCVQWVAEPGSQCPGRC
MGHAVRTQRLPTACQHHNGSDSSCNDRRRPTLRRNCTAGACDVCWRTGPWRPCTAACGRG
FQSRKVDCVHTRSCKPVAERHCVQKRKPASWRHCLGPSCDRACVDTTHYCMFVKQLNLCS
LDLYKRRCCQSCQEG
Download sequence
Identical sequences G1SI23
ENSOCUP00000002314 XP_008273501.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]