SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002360 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002360
Domain Number 1 Region: 1128-1323
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.04e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 921-1044
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-32
Family Pleckstrin-homology domain (PH domain) 0.00000063
Further Details:      
 
Domain Number 3 Region: 41-165
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-20
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002360   Gene: ENSOCUG00000002720   Transcript: ENSOCUT00000002723
Sequence length 1434
Comment pep:known_by_projection chromosome:OryCun2.0:16:954288:1105970:-1 gene:ENSOCUG00000002720 transcript:ENSOCUT00000002723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATRRTGLPEGDGDKLKACETPVLEVSKNKDGKEQSETVSPSEDEAFSWPGPKTVTLKR
TPQGFGFTLRHFIVYPPESAVQLSYKDEENGNRGGKQGKRLEPMDTIFVKQVKEGGPAFE
AGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDTALELSVMPKDEDILQVLQFTKDVTAL
AYSQDAYLKGNEAYSGNARNIPEPPPVCYPWLPSAPPAAAAQPAEASPADAPLSKQQTST
PGPTPPGRAYRMEIQVPPSPTDVAKSNTAVCVCNESVRSVIVPSEKAVDVLPGRGSHTGP
SHRTEEVRYGANEHTSLKAVSRATSPPSSVPAAHRIHHAAGSRSLDPSGGLLKSGNYAGH
SEGIPSDRAHAVDSPSIAVNHYSPNSHQRIDWKNYKTYKEYIDNRRLHIGCRTIQERLDS
LRAASRSTADYSQVAPGRAASQVRRRSTSHDRVPPAAQIRQRSVSQERLEDPVLTRYCPR
SASQGALTSPPVGLSQHRTRSWDYLEGQGEPAERQTPDSNGERAQASRWGGFAERDDRRG
VREAPKAFRGAHLSVAPGAVSVESRRVQFKKPPLDLKALQPSRTVPTACGAPLARGVAQD
RSPLVKVRSHSLKAPSAHAAAKPAVSQNSLVCTKDQRPVIHAHENSVLSQQTWFRPESAP
DHQADPAKPPSVSGAPAKPAAQTSENGAAAECELSVSLRDVDIRAAEAGAPQPHPADGTE
AVVLREKPPSGRQTPQPLRHQSYILAVNDQEAGSDSTCWLPNDARREVHIKRLEERKASS
ASPPGDSLASIPFIDEPTSPSIDHDIAHISASAVISASTSQVPCRATVPPSLTTSAPLIR
RQLSHDHDSIGPPSLDAQPTSKTERSKSYDEGLDDYREDAQLSFKHVCSLKASRITDSQK
SSEDSGSRKDSSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQMYVVLRGHSLYLY
KDKREQTAPCEEEQPISVNACLIDISYSETKRKNVFRLTTSDRECLFQAEDRDDMLAWIK
TIQDSSNLNEEDTGVTNRDLISRRIKEYNSLMSKAEQLPKTPRQSLSLRQTLLGAKSEPK
TQSPHSPKEEPERKLLGKDDTSPPKDRGMWIRGIPQIGRRKKPAATGTFGVRLDDCPPAH
TNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKGMADIDIQDDKWRDL
NVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLKRLIHDLPEHHYETLKF
LSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYKIVETLIQHHD
WFFTEEGAEEPLTTVRQESTVESQPVPNIDHLLSNIGRTGASPGDASDSATSDSTKSKGS
WGPGREQYSRELLVTSIFAAASRKRKKPKEKAQPSSSEDELDSVFSKKESMERC
Download sequence
Identical sequences G1SI61
ENSOCUP00000002360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]