SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002981 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002981
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 2.22e-60
Family Dystroglycan, domain 2 0.000000318
Further Details:      
 
Domain Number 2 Region: 497-598
Classification Level Classification E-value
Superfamily Cadherin-like 1.19e-18
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-17
Family Dystroglycan, N-terminal domain 0.00000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002981   Gene: ENSOCUG00000003439   Transcript: ENSOCUT00000003437
Sequence length 895
Comment pep:known chromosome:OryCun2.0:9:16989710:17069894:1 gene:ENSOCUG00000003439 transcript:ENSOCUT00000003437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSVGLSLLLPLWGRTFLLLLCVAVAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHEA
LPTVVGIPDGTAVVGRSFRVTIPTDLIGSSGEVIKVSTAGKEVLPSWLHWDPQSHTLEGL
PLDTDKGVHYISVSAAQLDANGSHIPQTSSVFSIEVYPEDHSEPQSVRAASPDLGEAAAS
ACAAEEPVTVLTVILDADLTKMTPKQRIDLLHRMQSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVEAPAREGTMSAQLGYPVVGWHIA
NKKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRD
PVPGKPTVTTRTRGAIIQTPTLGPIQPTRVSDAGTVVSGQIRATVTIPGYVEPTAVATPP
TTTTKKPRVSTPKPATPSTDSSATTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRI
RTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDKEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQ
GDKAPARFKAKFVGDPAPVVNDIHKKIALVKKLAFAFGDRNCSTVTLQNITRGSIVVEWT
NNTLPLEPCPKEQITGLSRRIAEDNGQPRPAFTNALEPDFKATSIAITGSGSCRHLQFIP
VAPPGIPSSVTPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPSQSVPETT
PLNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences Q28685
ENSOCUP00000002981 9986.ENSOCUP00000002981 ENSOCUP00000002981 NP_001095170.1.1745 XP_017199133.1.1745 XP_017199134.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]