SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003067 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003067
Domain Number 1 Region: 531-595,780-1120
Classification Level Classification E-value
Superfamily Ras GEF 1.96e-117
Family Ras GEF 0.0000155
Further Details:      
 
Domain Number 2 Region: 130-353
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-44
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 341-496
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000126
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000003067
Domain Number - Region: 3-63
Classification Level Classification E-value
Superfamily PH domain-like 0.0118
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000003067   Gene: ENSOCUG00000003533   Transcript: ENSOCUT00000003538
Sequence length 1123
Comment pep:known_by_projection chromosome:OryCun2.0:11:1452935:1638962:1 gene:ENSOCUG00000003533 transcript:ENSOCUT00000003538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTYYFTVLFGHEGQKPLELRCEEEQDGREWTEAIHRASYSDILIEREVLMQKYIHLVQIV
ETEKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYHSNQEDEDPDIKKIKKVQS
FMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFAMVEAESEYVHQLHVLVNGFLRPLR
MAASSKRPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLN
IYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIIT
LHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILL
DTSQTFIRQGSLIQVPSVERGKLSKVRLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLH
LLKTGGVLSLMECTLIEEPDASDDDAKGSGQVFGHLDFKIVVEPPEAAPFTVVLLAPSRQ
EKAAWMSDISQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDDTDICFSKTLNSC
KVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVLGTLADVYKRPFTSIP
ARSLELFFATSQGSRGEHLVDGKSPRLCRKFSSPPPLAASRTSSPVRARKLSLTSPLNSR
IGALDLTPSSASSSPTATHSPTASPPPHTAAALECAPAPAPTPAPAPAPAPAPASAERAG
ADGCPAPADTVGLSPCRSPCTPRHMRYRQPGGQPADSAYCSVSPASAFAIATAAAGHGSP
PGFNNTERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDP
DLLPQERKATANILRALSQDDQDDVHLKLEDIIQTADCPKAECFETLSAMELAEQITLLD
HVIFRSIPYEEFLGQGWMKLDKNERTPYIVRTSQHFNDMSNLVASQIMNYADISSRANAI
EKWVAVADICRCLHNYNGVLEISSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEG
RFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPDFTEEGLVNFSKMRMISHIIREIRQ
FQQTSYRIDHQPKVTQYLLDKALVIDEETLYELSLKIEPRLPA
Download sequence
Identical sequences G1SJX4
ENSOCUP00000003067 XP_008260101.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]