SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003778 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003778
Domain Number 1 Region: 176-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000161
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 2 Region: 215-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000205
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 141-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000664
Family EGF-type module 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000003778
Domain Number - Region: 64-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00224
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000003778   Gene: ENSOCUG00000004371   Transcript: ENSOCUT00000004374
Sequence length 385
Comment pep:known_by_projection chromosome:OryCun2.0:12:32902828:32906825:-1 gene:ENSOCUG00000004371 transcript:ENSOCUT00000004374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGCRCLRLVCLLCILGAPGQPARADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERC
VRMPGCQHGTCHQPWQCICHSGWAGKFCDKVSVVCMKTSPRRTCPFPLLSSLGAVRGLCP
APPRSCQELSIHVLSRPSLPSSPCRNGGQCQDDRGFALNFTCRCLAGFVGARCELNVDDC
LMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASHPCQRGARCRDRVHDFDCLC
PSGYGGKTCELVLPVAEPPTTAGTPLGPSSAAVAPVTGPAPHSAGAGLLRISVKEVVRRQ
DAGLGESSLVVLVVFGALTAALVLATMLLTLRAWRRGVCPPGPCCHPAPHYAPPCQDQEC
QVSMLPTVLPPAPELPPEPGKTTAL
Download sequence
Identical sequences G1SLN5
ENSOCUP00000003778 9986.ENSOCUP00000003778 ENSOCUP00000003778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]