SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004286 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004286
Domain Number 1 Region: 631-811
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-63
Family SPRY domain 0.00000597
Further Details:      
 
Domain Number 2 Region: 47-133
Classification Level Classification E-value
Superfamily DEATH domain 2.47e-24
Family Pyrin domain, PYD 0.0036
Further Details:      
 
Domain Number 3 Region: 407-468
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000366
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000004286
Domain Number - Region: 341-401
Classification Level Classification E-value
Superfamily RING/U-box 0.0107
Family RING finger domain, C3HC4 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004286   Gene: ENSOCUG00000004951   Transcript: ENSOCUT00000004953
Sequence length 817
Comment pep:novel scaffold:OryCun2.0:GL018828:481896:495831:-1 gene:ENSOCUG00000004951 transcript:ENSOCUT00000004953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHFLCLFHYFTSSLSSPTLGAAWADGLFSWRGQAPAQTLLVSAMAKTPSDHLLNTLEEL
VPYDFEKFKFKLQNTSLEKEHSRIPRGQLQMARPVRLATLLVTHYGEEHAVRLTLQVLRA
INQRLLAEELHRATEQASSNQDSCRFPSSVQDLLGKCPAAGRAPGSPKAAEGPEGEGQRQ
SGDGAASSPSGQPEAGRGPQKKPQVKRREPKCLGVDAQGRPGARRSPVLGRPPGDRPGPT
SARLRRNASSAGRLQGQCGAYPGKTEQKKLEVYLPSGKKRPKSLELISSRDREPPNPGTL
LPQEEAGTRKPASAATPRGAATHDAEAAQALEKSSRNPDHSLARRPQDKAACPLCHTQEG
DPVGTTCRRDSCSCPVAPAHPRASGGRLPGCPHCQVSLAWKSSRGLSPPPLPHCQRHMKQ
LLFCEDHGEPTCLICSLSQEHRGHRVRPIEEVALEYREQIQKQLEHLKQLRRCGEERRSQ
GDEKMEKFLKQTETQRQRVCCQLEQLFQFLEEQEQLFVAWLEELGQTIGQVREKYGTRVS
WNIALLDELIGELEAKQCKSEWELMQDIGVTLHRAKAVTVPEPWATPPEVKEKIQLLYQK
SEFIEKSMESFSETLRSEMETFNVPELISAQAHAVNVTLDAETSHPNLIFSDDLKSMRLG
NKWERLPEEPERFDSCIIALGSPSFLSGRHYWEVEVGDKTAWILGVCKASMSRKGSMILS
PENGYWVVMMKQNEYRVSTFPPTRLWMRELPRRVGIFLDYKTRNISFYNVTARSHMYTFT
SFSSSGPLQPIFSPGAHDRGKNMGPLTICPVGDQRLR
Download sequence
Identical sequences G1SMW1
ENSOCUP00000004286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]