SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004586 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004586
Domain Number 1 Region: 534-792
Classification Level Classification E-value
Superfamily NHL repeat 2.14e-47
Family NHL repeat 0.00000748
Further Details:      
 
Domain Number 2 Region: 383-479
Classification Level Classification E-value
Superfamily E set domains 1.73e-22
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 159-221
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000183
Family B-box zinc-binding domain 0.002
Further Details:      
 
Domain Number 4 Region: 68-142
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000442
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004586   Gene: ENSOCUG00000005292   Transcript: ENSOCUT00000005289
Sequence length 794
Comment pep:known_by_projection chromosome:OryCun2.0:15:9456418:9528954:1 gene:ENSOCUG00000005292 transcript:ENSOCUT00000005289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAALHVNKEDLASDACVGKETPLTLTTPQFCKQQRAGSKTAGPPCQWSRMASEGASIPS
PVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILP
EKGVAALQNNFFITNLMDVLQRTPGSNVEESSILETVTAVAAGKPLSCPNHDGNVMEFYC
QSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEII
HQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQES
IKSCSNFTAQALHHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLDFIVETEGLKK
SIHNLGSILTTNAVASETVATGEGLRQTIIGQPMSVTITTKDKDGELCKTGNAYLTAELS
TPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPT
TEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQ
GVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIA
DYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVT
RFGSRGNGDRQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFN
APTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVA
DSGNHCFKVYRYLQ
Download sequence
Identical sequences G1SNL6
ENSOCUP00000004586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]