SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005384 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005384
Domain Number 1 Region: 4872-5030
Classification Level Classification E-value
Superfamily SET domain 8.5e-49
Family Histone lysine methyltransferases 0.0065
Further Details:      
 
Domain Number 2 Region: 1097-1157
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000554
Family PHD domain 0.0039
Further Details:      
 
Domain Number 3 Region: 265-324
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000193
Family PHD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1172-1241
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000113
Family PHD domain 0.025
Further Details:      
 
Domain Number 5 Region: 1051-1105
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000151
Family PHD domain 0.016
Further Details:      
 
Domain Number 6 Region: 222-274
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000245
Family PHD domain 0.01
Further Details:      
 
Domain Number 7 Region: 1702-1752
Classification Level Classification E-value
Superfamily HMG-box 0.00000209
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005384   Gene: ENSOCUG00000006202   Transcript: ENSOCUT00000006217
Sequence length 5030
Comment pep:known_by_projection chromosome:OryCun2.0:4:33317916:33351737:-1 gene:ENSOCUG00000006202 transcript:ENSOCUT00000006217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQKPPGEDKDSEPAADGAAASEEPGAPEPELPSPHVGEASVPSPGSPRLQGPRGDCSE
GPARRCALCNCGEPSLHGQRELRRVELPCDWPRCPVVSPGGNPGPSEDLSQIGFPEGLTP
AHLGEPGGFCWAHHWCAAWSAGVWGQEGPELCGVDRPSSQGSHSGAGQRCSHCTRLGASI
PCRSPGCPRLYHFPCAAASGSFLSMKMLQLLCPEHSDGAAHLEEARCAVCEGPGELFDLF
FCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHTFC
LKPPMEELPAHSWKCKACRICRACGAGSAELSPHSEWFENYSLCHRCHRAQGGQPVSSVA
GQHPPVCSRFSPPEPGDTPTDEPDALYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLGRA
GTQLEPRLETPLNEEMPLLPLPEESPLSPPPEESPTSPPPEASRLSPPPEESPLSPPPES
SPFSPRETPLSPPPEASPLSPPLEESPLSPPPEELPTSPPPEASRLSPPPEESPMSPPPE
ESPMSPPPEASRLFPPFEESPLSPPPEESPLSPPPEASRLSPPPEDSPMSPPPEDSPMSP
PPEVSRLCPPPEESPLSPPPEETPTVAPPALSPLGELGYPFGAKGDSDPESPLAAPILET
PISPPPEAHCTDPEPVPPMILPPSPGSPLGPASPILMEPLPPPCSPLLQHSLPAPSPPPS
QCSPPALPLSVPSPLSPVGKAEELSDEPEPHEMETEKAPDPECPALEPSVTSPLLSPMGD
LSCPAPSPAPALEDFPGLGEDAAPLDGMDAARAQPEAGEAPGSELKGSPVLLDPEELAPA
TPMEVYGAECKQIGQGSPCDEQEEPCAAVAPTPPILIKSDIVNEISNLSQGDASASFPGS
EPLLGSPDPEAGGSLSMELGVSTDVSPARDEGSLRLCTDSLPETDDSLLCEAGTAVSGGK
AEGDKGRRRSSPARSRIKQGRSSSFPGRRRPRGGAHGGRGRGRARLKSTTSSVETLVVAD
MDGSPSKEEEEDDDDTMQNTVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQC
YHPYCVNSKITKVMLVKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLT
VPKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGPCASLVTCPICHAPYVEEDLLIQC
RHCERWMHAGCESLFTEDDVEQAADEGFDCVSCQPYVVKPVAPVAPPELVPVKVKEPEPQ
YFRFEGVWLTETGMAVLRNLTMSPLHKRRQRRGRLGLPGEAGLEGSEPSDALGPDDKKDG
DLDTEELLKGEGGVEHMECEIKLEGPASPDVEPGKEETEESKKRKRKPYRPGIGGFMVRQ
RKSHTRVKKGPAAQAEVLSGDGQPDEVMPVDLPAEGSGEQGLVDGDEKKKQQRRGRKKSK
LEDMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSDRKEPPTSQKG
DDGLDVADEESHGPEGKADTPAIAGPEDGGIKASPVPSDPEKPSTPGEGMLSSDLDRIPT
EELPKMESKDLQQLFKDVLGSEREQHLGCGTPGLEGSRTPLQRPFVQGGLPLGNLPSSSP
MDSYPALCQSPFLDSRERGGFFSPEPGEPDSPWTGSGGTTPSTPTTPTTEGEGDGLSYSQ
RSLQRWEKDEELGQLSTISPVLYANINFPNLKQDYPDWSSRCKQIMKLWRKVPAADKAPY
LQKAKDNRAAHRINKVQKQAESQINKQTKVGDPARKTDRPALHLRIPPQPGAMGSPPPAA
APAVFIGSPTPPAGMSTSADGFLKPPAGTVPGPDSPGELFPKLPPQVPAQVPSQDPFGLA
PAYALEPRFPAAPPAYPAYPSPAGAPAQPPVPSASARPGTGLPGEFHSTPPGTPRHQPST
PDPFLKPRCPSLDNLAVPESPGVGGGKASEPLLSPPPLGESRKALEVKKEELGASSPSYG
PPNLGFVDPPSSGPHLGGLELKAPDVFKAPLTPRASQVEPQSPGLGLRPQEPPPAQALAP
SPPSHPDIFRPGPYPDPYAQPPLTPRPQPQPPESCCALPPRSLPSDPFSRVPASPQSQSS
SQSPLTPRPLSAEAFCPSPVTPRFQSPDPYSRPPSRPQSRDPFAPLHKPPRPQPSEVAFK
AGPLAHTPLGAGGFPAALPSGPTGELHAKVPSGQPPSFARSPGTGAFVSTPSPMRFTFPQ
AVGEPSLKPPAPQPGLPPPHGINSHFGPGPTLGKPQSTNYAVATGNFHPSGSPLGPGSGS
TAEGYGLSPLRPTSVLPPPAPDGSLPYLSHGASQRASITSPVEKREEPGAGMSSSLVAPE
LPGTQDPGMSSLSQTELEKQRQRQRLRELLIRQQIQRNTLRQEKETAAAAAGAVGPPGGW
GAEPSSPAFEQLSRGQAPFAGTQDKGSLVGLPPSKLGGSVLGPGAFPSDDRLSRPPPPAT
PSSMDVNSRQLVGGSQAFYQRTPYPGSLPSSMRLAMSTRFPSAPGPELSRQALGSPLAGI
PTRLPGPGEPVPGPAGPAQFIELRHNVQKGLGPGGAPFPGQGPPQRPRFYPVSEDPHRLA
PEGLRGLALSGLPPQKPSAPPAPELSNSLHPPSHTKGPTLPAGLELVSRPPSSTELGRPP
PLALEPGKLACEDPELDDDFDAHKALEDDEELAHLGLGVDVAKGDDELGTLENLETNDPH
LDDLLNGDEFDLLAYTDPELDTGDKKDIFNEHLRLVESANEKAEREALLRGVEPGPLGSE
EHPAPIADAAEPRLASVLPEVKPKVEEGGRHPSPCQFTITTPKVEPAPATTSLGLGVKPG
QTVMGSREPRIGTGPFSSSGHAAEKAPFGATGGPPAHLLAPSPLSGPGGSSLLDKFELES
GSLSLPGGPAASGDELDKMESSLVASDLPLLIEDLLEHEKKELQQRQQLSAQLQPTHPLL
SAAGPAQAMPLPHEGSSPSLSGPQQQLSLGIGGARQPGLGQPLMPTQPPAHALQQRLAPS
MAMVSNQGHMLSGQHGGQASLVPQQSPQPVLSQKPMGTMPPSMCMKPQQLAVQQQLANSF
FPDTADLDKFAAEDIIDPIAKAKMVALKGIKKVMAQGSIGVAPGMNRQQVSLLAQRLSGG
PGSDLQNHVAPGSGQERNAGDPSQPRPNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQL
KVLEEQIGVHRKSRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQ
KEHTNLMAEYRNSAVLALSPSQSPRLLTKLPGQLLPGHGLQPLQGPPGGQAGGLRLPPAG
MALPGQPGGPFLNSSLDSGGAGSLAGPSGGFFPGNLALRSLGPDSRLRPGVQANQALGPK
PQGLLPPSNHQGLLVQQLSPQPPQGPQGMLGPAQVAVLQQQHPGALGPQGPHRQVLMTQN
RVLSSPQLAQQGQGLMGHRLVTGSMAGLSHLQQGLMSHSGQPKLNAQSMGSMGLLNQSRT
LLSPQQPQQQVTLGPGMPAKPLQHFSSPGALGPTLLLPGKEQNVETALPSEGTEGSSAHQ
GGGPLAVGATPEPMAAEPGEVKPSLSGDSQLLLVQPQAQPQPSSLQLQPPLRLPGQQQQQ
QVNLLHTAGVGSHGQLGSGSSSEASAMPHLLVQPSASLGDQPGPMTQNLLGPQPPLGLER
PMQNNAGQQPPKAGPVPQPGQALSGVGVMPTVGQLRAQLQGVLAKNPQLRHLSPQQQQQL
QALLVQRQLQQSQAVRQTPPYQEPGTQSSPLQGLLSCQPQPGGFPGSQTGPLQELGAGPR
PQGPPRLPVPQGALSTGPTLGPVHPTPPPSSPQEPKRPSSQLPSPSAQLTPTHPGTPKPQ
GPTLELPPGRVSPAAAQHTDTFFGKGLGPWNPPDNLAETQKPEQSSLVAGQLEQVNGQAV
PEPPQLSIKQEPREEPCALGAQVVKREANGEPVGTPGTSNHLLLAGPRSEAGHLLLQKLL
RAKNVQLSAGRGPEGLRTEINGHIDSKLAGLEQKLQGTPINKEDVAARKPLTPKPKRVQK
AGDRLVSSRKKLRKEDGVRASEALLKQLKQELSLLPLTEPTITANFSLFAPFGSGCPISG
QSQLRGAFGSGALPTGPDYYSQLLTKNNLSNPPTPPSSLPPTPPPSVQQKMVNGVTASEE
LGEHPKHAPAARDTEGMQRDASEVKSLDLLAALPTPPHNQTEDVRMESDEDSDSPDSIVP
ASSPESILGEEAPRFPQLGSGRWEQDDRALSPVIPIIPRASIPVFADTKPYVALDLDVPG
KLPAATWEKGKGSEVSVMLTVSAAAAKNLNGVMVAVAELLSMKIPNSYEVLFPESPARAG
MEPKKGEVEGPGGKEKGLGGKSPEAGPEWLKQFDAVLPGYSLKSQLDILSLLKQESPAPE
PPTQHSYTYNVSNLDVRQLSAPPPEEPSPPPSPLAPSPASPPAEPLVELPLEPSAEPPVP
SPLLLASSPESARPKPRARPPEEGEDSRPPRLKKWKGVRWKRLRLLLTIQKGSGRQEDER
EVAEFMEQLGTALRPDKVPRDMRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWST
EVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFK
DKTMLCPMHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHA
IGQLLPHQMADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSIGENNGRPEFMVKVME
QGLEDLIFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAES
LPGVESCQNYLFRYGRHPLMELPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKAYQST
FTGETHTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYI
GTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVT
FDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAWNCRKWMN
Download sequence
Identical sequences G1SQK2
ENSOCUP00000005384 9986.ENSOCUP00000005384 ENSOCUP00000005384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]