SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005605 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005605
Domain Number 1 Region: 268-444
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.09e-24
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0069
Further Details:      
 
Domain Number 2 Region: 217-262
Classification Level Classification E-value
Superfamily TGS-like 0.0000425
Family TGS domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005605   Gene: ENSOCUG00000006485   Transcript: ENSOCUT00000006484
Sequence length 471
Comment pep:known_by_projection chromosome:OryCun2.0:14:154711592:154738495:-1 gene:ENSOCUG00000006485 transcript:ENSOCUT00000006484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTGQMDATAQAPARPSRGALPAQLRGKPELEEAMGRREPGDSGGCGARGTQPLPGRRPV
SLTAHEVLGHPSRPWNTQGRGACDSEAQRRPLMAARSPERPERNCRAEPRCAFRVSGGRK
AGEDRRAAVPTAAVKAMAVGVRMLRLCRVVPGCGAGWRWIATAAAQLTPPELTEMRNDLF
NKEKKRQLSLTPRTEKIEVKHVGKTDPGAVFVMNKNVSTPYSCAMHLSEWYCRKSILALV
DGQPWDMYKPLTKSCEIEFLTFKDRDPGEVNKAYWRSCAMMMGCVIERAFKDEYVVSLVG
APEVPVIAGAFCYDVVLDKKLDEWMPTKENLRSFTKDVHALIYKDLPFETLEVEAKVALE
IFQHNKYKIDFIEEKASQNPERIVKLHRIGDFIDVSEGPLIPRTGICFQYEVSAVHNLHP
TQPSLVRRFQGLSLPVHLRAHFTIWDKLLERSRKLVTANQSKRTEENVTTQ
Download sequence
Identical sequences G1SR36
ENSOCUP00000005605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]