SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006212 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006212
Domain Number 1 Region: 46-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.78e-37
Family SCAN domain 0.0000636
Further Details:      
 
Domain Number 2 Region: 961-1017
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.46e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 876-933
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 758-809
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-16
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 5 Region: 711-768
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000133
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 923-955
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000922
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006212   Gene: ENSOCUG00000007192   Transcript: ENSOCUT00000007191
Sequence length 1036
Comment pep:known_by_projection scaffold:OryCun2.0:GL018704:4810401:4848765:-1 gene:ENSOCUG00000007192 transcript:ENSOCUT00000007191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVLDSWAQASPPPEPEDFLIVKLEEDSWGSESKPLENHHDPVPGPEASRQRFRQFQYR
DAAGPHEAFSQLWALCCHWLRPEIRLKEQILELLVLEQFLTILPKEVQTWVQARHPESGE
EAVALVEDWHREAQAAGQQEVELCAKEAKSLKAVEESQCFQLQAVDHWPEEQSQKQWVKD
PCSDLPKHLDAKVAPQPLKESAVLTPRVPAVPKMGSVGDWEVAVESQEALGPGKPAETEF
CNDPLGDDCGDRVCLGVPVAKPSVTSQQEQGPEFWGLSPVNSRERNATDYSLDNEQTEAA
PALSWKDSRAWEEQCQWDVEDTKVSGVHWGYEETKTFLAILSESPFSEKLRTCHQNRQVY
RAIAERLRARGFLRTLEQCRYRVKNLLRNYRKAKSSQPPGTCPFYEELEALMRSRMTVRA
TDSPGEAMALPRLGDSDAEMDEQEEGGWEPEETAECCNGAGLATEESTQGHKIAGGSNLL
QSRIAGVHWGYEETKTFLAILSESPFSEKLRTCHQNSQVYRAIAERLCALGFLRTLEQCR
YRFKNLLRSYRKAKSTHPPGTCAFYEELDSLMRARTAVRALTTVREAPGLPWSGQSSTET
WAETAGEDAIKPGTPDTGFEMRCEDGDQTSEQDAVEELPGHLSEWTPDAICQAGDWGDDS
DNENNGEGAWEDPPEEQWEECSSEEDLEKLIDHQGLYLAEKPYKCNSCVRSFSQSSPFLA
HQQKHTEEKAYACGECGKGFRHGSHCSAHPRLRAGEQPYRCLECEKSFSDHSSLIAHQKT
HIGEKPYKCGECWESFNKSSNLLKHQRIHGGGNLDPRGEPGENLGGNPSCSPRRRRAAGE
TAPEEPPRVRKNLRASGLHGANSGEKLYQCPECGRSFSKSSALISHQRIHTGEKPFECGE
CGKSFSKSSTLANHQRTHTGEKPHQCADCGKCFSERSKLITHQRVHTGEKPYKCPECGKF
FRDRSNLITHQRIHTGEKPYQCRECGKCFNQSSSLIIHQRIHTGEKPYKCTECGKDFNNS
SHFSAHRRTHTGRKES
Download sequence
Identical sequences G1SSI5
XP_008271941.1.1745 XP_008271942.1.1745 ENSOCUP00000006212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]