SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006478 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006478
Domain Number 1 Region: 718-775
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 24-64
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000929
Family Somatomedin B domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000006478
Domain Number - Region: 60-132
Classification Level Classification E-value
Superfamily E set domains 0.000154
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006478   Gene: ENSOCUG00000007488   Transcript: ENSOCUT00000007489
Sequence length 818
Comment pep:known_by_projection scaffold:OryCun2.0:GL018810:719900:729878:-1 gene:ENSOCUG00000007488 transcript:ENSOCUT00000007489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLVLLPWALLLLATGPRPTAGAQDSCSLRCGDRNGPCSCHPTCSGFGTCCSDFQAFCLK
IVPSSGSMMGGKDLVVQHLQWFNPTDGVICRFKDSIDTLGHVDSQGRVHCVSPLLYETGH
IPFNVSMDNGRTFPRAGTWLAMHPYKVSEMEKSQLVNETRWQYYGTPGTTGNLSLTWDRS
VLPTQAVNIELWGYEETGMPYSEEWAAKWSYLYSLATNVSNSGSFTFTPKPAPSQYQQWK
IGALRITASQNHAGQKDVHALWTNDHALAWHLEDDFRMAPEAWARNQCLAWEKLDDQMPN
FLEELPDCPCTLAQARADTGRFHTDYGCDLEHGSVCTYHPDAVHCVRSVQASTQYAAGQQ
CCYTKDGSQLLTADSTSGSTPDRGHDWGSPPYRRPPRVPGMSHWVYDVISFYYCCLWAPE
CPRYMQRRPSSDCHTYRPPRLASAFGDPHFVTFDGTNFTFNGRGEYVLLEASLTDLRVQA
RAQPGISANGTRDRGTGLTAVAVQEGNSDVVEVRLADGSGVLEVLLNQEVLSFAEQSWMD
LKGMFLSVATSDKASIMLASGAGLEVGVQGPFLSVAVLLPEKFLTHTRGLLGTLNNNPMD
DFTLRSGEVLPPNPSAQQLFQFGADWAVNNASSLLTYDSWFLVYNFLYRPKHDPDFRPLF
PNETSLNPSQAEEVARVCGDDPFCSFDVLATGSLSVGNATRAAHQLHQFRVQSLQPVVTC
GWLAPPANGSKEGIRYTLGSTIRFRCDSGYSLAGAQTSTCQADGTWSAPTPKCHQGGRSY
TVLLSIIFGGLAVVGGVALVYALLRHRKGNMSMWPTQP
Download sequence
Identical sequences G1ST60
ENSOCUP00000006478 XP_002722603.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]