SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006835 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006835
Domain Number 1 Region: 331-387
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-20
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 2 Region: 614-1069
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000000000834
Family Hermes transposase-like 0.0085
Further Details:      
 
Domain Number 3 Region: 8-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000523
Family KRAB domain (Kruppel-associated box) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006835   Gene: ENSOCUG00000007913   Transcript: ENSOCUT00000007911
Sequence length 1160
Comment pep:known_by_projection scaffold:OryCun2.0:GL018806:766289:796524:-1 gene:ENSOCUG00000007913 transcript:ENSOCUT00000007911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRESGKAPVTFDDITVYLLQEEWMLLSQQQKEICGSDKLVAPLGPTVANPELFYKFGQ
GPEPWLGDVQGQRSLLDHHPGKKQMGYLEEMDMQGPARESGQFLPSQERACLTHFSPESH
NIEGDWTGRGKKSPRPRSIQKSWFAQFPWLIMNEEQTALYCSACREYPSVRDKRSRLIEG
YTGPFKVETLKYHAKSKAHTFCVNALAAKDPIWAARFRSIRDSSGDVLDSPEHLFSADYP
MFCPSGPLGDSKSGAELLPSSRAELEDPRENGAIPALYLNCIADSRPKESTDDTTNSSNV
NILYNDAVELCSQDPPEEGLLEEVPVVFEALPVVFEDVAVYFTREEWGMLDKRQKELYRD
VMRMNYELLASLGPAAAKPDLISKLERRTAPWIKDPNGPKLGKGCPPGKKKMVAVREVDT
QASCVESVSLPAPSVETCPSYCSSSIHEGDRDAPRKIKRTYRPRSIQRSWFGQFPWLVID
PKEAKLFCSACREKPTLHDKSSRLVRGYTGPFKVETLKYHEVSKAHKLCINTVEIRDDVP
QATLVPEISSDLMANMEHFFHAAYSIAYHSRPLNDFEKILQLLQSTGTVILGKYRNRTAC
TQFIKYISETLKKEILHDIRNSPCVSMLLDSSTDASDQACVGIYLRYFKQMEVKESYITL
APVHSETVDGYFETIVSALDELDIPFRKPGWVVGLGTDGSTMLSCKGGLVEKFQEIIPQL
LPVHCVAHRLHLSVVDACGSIDLVKKCDRHIRTIFKFYQSSNKRLNELQAGAAPLEREII
RLKDLNAIRWVASKRRTLSALISGWPALASHLQSVAEAGGQIGHRAKGMLKLMKGFHFIK
FCHFLLDFLSIYRPLSEVCQKEVVLITEVNSTLGQAYVALETLRHQAGPKEEEFNASFKD
GQLHGIFLDRMEMAEQRFQADRERMILTGVEYLQQRFDTDRPPQLKNMEVFDTMAWPTGL
ELASFGNDDILTLARYFELSLPTAYSEKALLEEWLGLKAIAQNLPFSMLCKNALAQQHRF
PLLSKLMAVVVCVPISTSCCARGFKAMNRIRTDERTKLSNEVLNTLMMTAVNGVAVTEYD
PQPAIQHWYLTSSGRRFSHVYASAGLRKQEVGALHTRGSLTQKQPITPSGESEEVLKDCI
TEPTERLLYPHASQGAPELS
Download sequence
Identical sequences G1SU25
XP_008248313.1.1745 ENSOCUP00000006835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]