SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007062 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007062
Domain Number 1 Region: 811-1001
Classification Level Classification E-value
Superfamily Nucleotide cyclase 6.75e-63
Family Adenylyl and guanylyl cyclase catalytic domain 0.00012
Further Details:      
 
Domain Number 2 Region: 40-425
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.04e-59
Family L-arabinose binding protein-like 0.00034
Further Details:      
 
Domain Number 3 Region: 507-776
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.84e-47
Family Protein kinases, catalytic subunit 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007062   Gene: ENSOCUG00000008162   Transcript: ENSOCUT00000008169
Sequence length 1074
Comment pep:known chromosome:OryCun2.0:8:24855147:24947643:1 gene:ENSOCUG00000008162 transcript:ENSOCUT00000008169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLLLGLVLWSLLFQLGLMFWATQVSQKCHSGNYEISVLMMNNSAFPESLDNLKEAVIE
GMDIVRQRLHEAGLNVTVNATFIYSDGLIHKSGDCRSSTCEGLDLLREITREKQMGCVLM
GPSCTYSTFQMYLDTQLNYPMISAGSFGLSCDYKETLTRLMPPARKLMYFLVNFWKVNDL
PFKPFSWDSSYIYKDGSETEDCFWYLNALEAGVSYFSQELNFKDTLRKEDEFRNILTDLN
RKSNVIVMCGKPKVIDNLKDDWTVAEDTVIILVDLFNNYYFNDSVTAPDYMKNFLVLTLP
PGNFTLNNSFSKDVLPARNDFTLAYLDGTLLFGHMLKTFLKNGENITTSKFAHAFRNLTF
QGYTGPVTLDDCGDIDTTMILLYTSVDTKKFKVLLTYDTRVNNTIPVDMSPTFVWKNHKL
PNDIPGRVPEIVLMASTTLSSFLLVLCLLNILLLNRKYKRDHELRQKKWSHIPPENIFPL
ETNETNQVSLKIDDDRRRDTIQSLRQCKYDKKRVILKDLKHSDGNFTEKQKIELNKLLQI
DYYNLTKFYGTVKLDSRIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAK
GMSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKRDLWMAPEHLRHSRTSQ
KGDVYSYGIIAQEIILRRETFYTQSCWDQNEKLFRVENANSMKPFRPDLFLETAEENEVE
VYLLVKNCWEEDPEKRPDFKKIENILAKIFGLFHDQKSESYMDTLIRRLQLYSRNLEHLV
EERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGIVEPELYEEVTVYFSDIVGFTTICKY
STPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHALDIAKMALE
ILSFMGTFELEHLPGLPVWIRIGIHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLP
LRIHMNGSTLSILKRTECQFLYEVRGETYLKGRGTEITYWLTGMKDQEYNLPAPPTVENQ
QRLQAEFSDMIANSLQKRQAAGIRSRKPTRVASYKKGTLEYLQLNTTDKEVTYF
Download sequence
Identical sequences G1SUM0
ENSOCUP00000021424 ENSOCUP00000007062 9986.ENSOCUP00000007062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]