SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008432 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008432
Domain Number 1 Region: 468-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.43e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 510-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 346-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000219
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 6 Region: 431-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000441
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 220-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000862
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 8 Region: 266-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000242
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008432   Gene: ENSOCUG00000009791   Transcript: ENSOCUT00000009788
Sequence length 575
Comment pep:known_by_projection scaffold:OryCun2.0:GL018805:57543:66393:1 gene:ENSOCUG00000009791 transcript:ENSOCUT00000009788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEQVSFKDVCVDFTQEEWYLLDPAQRVLYRDVILENYSNLVSVGYCFTKPEVVFKIEQGE
EPWILEKGFSSQSHSERKWGVDGPSESSQGDPDEHFWQLVFTSNNTVSAESGDRVRKISN
LGADPVSSRNFPCKICDSCELSLKNISGLLTGKKNYSRKKSNELNVCEKLLLDIRHEKIA
AGGKSGKYLQKRNVLSHHHGLTQPGFDPPFQYNENGQGFPEEAAFLTHQRSQLGETVCKY
NECGRTFIDSLKLRGSPRTHLEMEPDECSVCGKSFYMDLRFGHQRALTRDNLYEYNEYGQ
IFCDNSTFIIHQGAYSRKISQEYKVSDKTWEKPPLFKHQIVHMVEKPYDYKENGNNFSKK
SHLTQLRRGHSGEKTFECGECGKTFWEKSNLTQHQRTHTGEKPYECAECGKAFCQKPHLT
NHQRTHTGEKPYECKQCGKTFCVKSNLTEHQRTHTGEKPYECNVCGKSFCHRSALTVHQR
THTGEKPFICNECGKSFCVKSNLIVHQRTHTGEKPYKCNECGKTFCEKSALTKHQRTHTG
EKPYECNACGKTFSQRSVLTKHQRIHARVKALSAS
Download sequence
Identical sequences G1SXX4
ENSOCUP00000008432 9986.ENSOCUP00000008432 ENSOCUP00000008432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]