SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008536 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008536
Domain Number 1 Region: 230-383
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.62e-27
Family DnaQ-like 3'-5' exonuclease 0.00063
Further Details:      
 
Domain Number 2 Region: 505-666
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.32e-18
Family Canonical RBD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008536   Gene: ENSOCUG00000009913   Transcript: ENSOCUT00000009913
Sequence length 783
Comment pep:novel chromosome:OryCun2.0:6:11740942:11814124:1 gene:ENSOCUG00000009913 transcript:ENSOCUT00000009913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEKDGTGGHPRKDRKRKRAPNKQIGASEAMRARWDLEEERQPEAKKPRLSTVLLAENC
EVTHGQLCELLKYAVLGKSCVSKPRWCQLFHQNRLKNVVVFVLQGMSQLHFYRFYLELRF
LRKAFRHKFRLPPPSSNFLADIIGLKKKEPTGDLPKTLEESLPSAISKASINLQNDPIVR
KYGLKKVSLIRCLLTKEEMKTFSFPLQGFPDCENFVPTKCDGSVTENSPLFGLDCEMCLT
SKGRELTRVSLVAEGGACLMDELVKPDNKILDYLTRFSGITKKILNPVTTKLKDVQRQLK
ALLPPDAVLVGHSLDLDLRALKMIHPYVIDTSLLYIREQGRRFKLKFLAKAILGKDIQCP
NKLGHDATEDARTTLELAQYFLKYGPKKIAELNLHALVHHQELQAASQEPRNTPGVIQHS
NTSVIECLDSLGQKLLFLSQDTDASDLFSKNCKTIKCLSNKQVLEQARVEIPQFPFSIVE
FSFEPFAPMLTEEMNKRMRLKWTQMSTVYAGPFSKNCNLRALKRLFKSFGPVRSITLILE
THQPHLCVQYEVLEAAQLAIESLDGILVEGICIKVQRPVTELTLDGDTLVNELELDSENR
GTIYLSGVNENFKDCLLQQSSLFLGLEAVILPKDLKSGMPKKYCFLKFKTFGSAQRALTI
LKGKEWKLKGRHALTPRHLHTWLRGLPPESRSPPGLHVIPSPSEQQSLQTLKVDHPKVAA
WRWGRKIEKLYRSLCPGTLCLILLPGTQSIHGALSGLGLVGIKDEEESTIPNMCFSLIRC
PIH
Download sequence
Identical sequences G1SY60
ENSOCUP00000008536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]