SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008832 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008832
Domain Number 1 Region: 38-313
Classification Level Classification E-value
Superfamily L domain-like 2.11e-56
Family Ngr ectodomain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 235-475
Classification Level Classification E-value
Superfamily L domain-like 2.38e-40
Family Ngr ectodomain-like 0.0049
Further Details:      
 
Domain Number 3 Region: 538-840
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.93e-28
Family Rhodopsin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008832   Gene: ENSOCUG00000010236   Transcript: ENSOCUT00000010242
Sequence length 955
Comment pep:known_by_projection chromosome:OryCun2.0:16:69360174:69483805:-1 gene:ENSOCUG00000010236 transcript:ENSOCUT00000010242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPAELRALWLCAALCVSPSAAAACPAPCHCQEDGIMLTADCSELGLCAVPGDLDPLTA
YLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLCSLKILMLQNNQLRGV
PAEALRELPSLQSLRLDANLISVVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQ
AMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLDLNYNELQEF
PVAIRTLGRLQELGFHNNNIKAIPEKAFVGNPLLQTIHFYDNPIQSVGRSAFQDLPKLHT
LSLNGATDIQEFPDLKGTTSLETLTLTRAGIRLLPPGLCQQLPRLRVLELSHNQIEELPS
LHRCQKLEEIPSGLQHNRIWEIRADTFSQLSSLQTLDLSYNAIRSIHPEAFSTLRSLVKL
DLTDNQLTALPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAYQCCAYGVCAS
FFKASGQWEVQDLHLDDEEAPKRPLGLLAGPAESHYDLDLEELQLEMEDSKPHPSVQCSP
VPGPFKPCEHLFESWGVRLAVWAIASLSVLCNGLVLLTVFAGGPAPLPPVKFVTGAIAGA
NALTGISCGLLASVDALTFGQFAEYGARWEMGLGCRATGFLAVLGSEASVLLLTLAAVQC
SISVSCVRAYGKAPSPGSVRAGALGCLMLAGLAAALPLASVGDYGASPLCLPYAPAEGQP
AALGFAVALVMMNSFCFLVVAGAYIKLYCDLPRSDLEAVWDCAMVRHVAWLIFADGLLYC
PVAFLCVASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRRLWPCTGS
PGSLACAAARELEKSSCESTQALVAFSDVDIVLDASEAGRPPGLETYGFPSVTRVPCQQP
GAPSLESSHCAEPEGPCSGKPPPTVDGELLLKAEGAPPPPGRAFRHSSGAFGSHV
Download sequence
Identical sequences G1SYX1
9986.ENSOCUP00000008832 ENSOCUP00000008832 ENSOCUP00000008832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]