SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008933 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008933
Domain Number 1 Region: 236-481
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.13e-90
Family Eukaryotic proteases 0.0000353
Further Details:      
 
Domain Number 2 Region: 146-242
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-19
Family Hepsin, N-terminal domain 0.04
Further Details:      
 
Domain Number 3 Region: 125-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000772
Family LDL receptor-like module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008933   Gene: ENSOCUG00000010366   Transcript: ENSOCUT00000010370
Sequence length 489
Comment pep:novel scaffold:OryCun2.0:GL018782:39321:67941:-1 gene:ENSOCUG00000010366 transcript:ENSOCUT00000010370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGGRPNASPVRATPARPYPSRSSSDGSSSARSASVTSSPTRVHLVRATPVGAAPVRAS
PASSAPATREGPGTSGPKFSWQEGQKRLPLIGCILLLIALVVSLIVLFHFWRGHTGIKYK
EPVESCPSHTVRCDGVVDCKLQSDELGCVRFDWDSSLLKVYSGPSHQWLPVCSHSWNDSF
SEKTCRQLGFKSAYRTTEVALRDVTSSFSVSEYNSTIQESLHRSECPSQQYVSLQCSHCG
LRAMTGRIVGGALAPESKWPWQVSLHYGTTHICGGTLIDAQWVLTAAHCFFVTREKILEG
WKVYAGTNNLHQLPEAASISQIIINGNYTDEQDDYDIALMRLSKPLTLSAHVHPACLPMH
GQTFSLNETCWITGFGKTKETDEKTSPFLREVQVNLIDFRKCNDYLVYDSYLTPRMMCAG
DLRGGRDSCQGDSGGPLVCQQNNRWYLAGVTSWGTGCGQRNKPGVYTKVTEVLSWIYSKM
ESETRFRKS
Download sequence
Identical sequences G1SZ52
ENSOCUP00000008933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]