SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009249 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009249
Domain Number 1 Region: 754-981
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-60
Family DBL homology domain (DH-domain) 0.00000000147
Further Details:      
 
Domain Number 2 Region: 350-526
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.14e-54
Family Regulator of G-protein signaling, RGS 0.000000028
Further Details:      
 
Domain Number 3 Region: 986-1119
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-43
Family Pleckstrin-homology domain (PH domain) 0.000000317
Further Details:      
 
Domain Number 4 Region: 28-121
Classification Level Classification E-value
Superfamily PDZ domain-like 7.89e-21
Family PDZ domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000009249
Domain Number - Region: 149-159
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009249   Gene: ENSOCUG00000010731   Transcript: ENSOCUT00000010739
Sequence length 1561
Comment pep:known_by_projection chromosome:OryCun2.0:13:35925920:36045492:1 gene:ENSOCUG00000010731 transcript:ENSOCUT00000010739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDTSETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGVSGLQQDPSPAGAPRVTPMIPPPPPPPPLPPPQRITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDILPLY
GDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNRNSVLSDPGLDSPRTSPVIMT
RVAQHHRRQGSDATVPSTSDQGVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSR
PAHLGVFLRYIFSQADPSPLLFYLCAEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKIP
EMLQAEIDLRLRNSEDVRSALSEAQGAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLD
GDLLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSSTAEKAQ
AAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEV
KPGNVRNIIQHFENSQQCDAPEPGTQRLSTGSFPEDLLESDSSRSEVRLGRSESLKGREE
MKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSI
ESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDAQNWQHTVGKDVVAGLAQREIDRQEVIN
ELFVTEASHLRTLRVLDLIFYQRMKKENLLPRDELARLFPNLPELIEIHNCLCEAMKRLR
EEGPIIRGIGDLMLSRFDGAAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEA
ESHPQCRRLQLRDLIISEMQRLTKYPLLLESVIKHTEGGTSEHEKLCRARDQCREILKYV
NEAVKQTENRHRLEGYQKRLDASALERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKDK
TLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAAGSADSKQTFSPVLKLNAVLIRSVATDK
RAFFIICTSELGPPQIYELVALTSSDKNTWMELLEEAVQNATRHPGAAPTPIHAPAPGPQ
EQAHQGPTPSRLDLDDSEVFHSEPEAEEPLEAGPGPPQRGQGMQPVLLGDPEQRGHGEEE
LGALPDPPAPLGGENSTIRTRDPFHLALPGPLFMEGLADSALEDVENLRHLILWSLLPGH
TPETQTAREPEDDLTPTPSVISITSHPWDPGSPGRAPAAGEGDSTQLPGPERGQPEQDTA
LSSLEHLPPRTRNSGIWESPELDRNPAEEASRTEGTGNYKVVRKAEVAGGKGVPALPESG
QSEPEPPEAEGGTKAAGNCFYVSMPAGPLDSSTDLPEAPASPCQPDGLPAWQTEPRPQLQ
GGSEDPRRPSCSAPSLALRDVGMIFQTIEQLTLKLNRLKDMELAHRELLKSLGGESSGGT
TPVGSFHTEPARWTDSSLSPPAKEPLDPDSGNSRELGPCPEDGPDTALEYGAADAATSPG
L
Download sequence
Identical sequences G1SZW2
ENSOCUP00000009249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]