SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010218 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010218
Domain Number 1 Region: 25-143
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.01e-29
Family Hormone receptor domain 0.0022
Further Details:      
 
Domain Number 2 Region: 126-415
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000806
Family Rhodopsin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010218   Gene: ENSOCUG00000011885   Transcript: ENSOCUT00000011889
Sequence length 453
Comment pep:known_by_projection scaffold:OryCun2.0:GL019006:250460:255799:1 gene:ENSOCUG00000011885 transcript:ENSOCUT00000011889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSWAPWRLLLLSLAGLPLWSAEDLREQTAGELYRRWERYRRECQETLESAEPPSGLACN
GSFDMYVCWDYAAPNATARASCPWYLPWHRQVAAGFVLRQCGSDGQWGPWRDHTQCENPE
KNEAFQDQRRILEWLQAVYTIGYSLSLATLLLALLILGVFRRLHCTRNYIHINLFASFTL
RAAAILSRDRLLPPPGPHPGDQAPALWNEALAACRTAQILTQYCVGASYTWLLVEGLHLH
SLLVFPGGSEEGHFRCYLLLGWGAPALFVFAWVIVRYLYENTQCWERNDVKAIWWIIRTP
ILITILINFLIFIRILGVLVSKLRTRQMRCPDYRLRLARSTLTLVPLLGVHEVVFAPVTE
EQARGALRLAKLGFEIFLSSFQGFLVSVLYCFINKEVQSELRRGWRGWRHCRSQRCLGEE
PRQRPERASRALPPSGTLPGPGDEASRVLESYC
Download sequence
Identical sequences G1T265
9986.ENSOCUP00000010218 ENSOCUP00000010218 ENSOCUP00000010218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]