SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010977 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010977
Domain Number 1 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.86e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 20-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 7 Region: 503-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 195-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010977   Gene: ENSOCUG00000012767   Transcript: ENSOCUT00000012759
Sequence length 563
Comment pep:novel scaffold:OryCun2.0:GL018792:546866:569646:-1 gene:ENSOCUG00000012767 transcript:ENSOCUT00000012759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPEEEAPKRRKREDKVSQMALTQGRLTFRDVAIDFSQEEWKCLDPDQRALYRDVMLENY
KNLVSLGISPTCVVKEICPKGDSNTGEIFQTLSLERNERNDVKDFSPREVQKNQNDFEFQ
WNNDEGNLNDLFIIHKENLISRRDQHDRKDARSSVLKTCLGSSFQSHLPELQIFPSESEI
DECNYIEQSINNREKPYKCNECGKVFSSHSNLNTHQIIHRGEKPYKCYECGKVFTQNSHL
ANHRRIHTGEKPYKCNECGKAFSVYSSLTTHQAIHTGEKPYKCNECGKVFTQNSHLASHR
GIHTGEKPYKCDECGKFFSQTSNLARHLRVHTGEKPYKCNECGKSFSVRSNLIAHQVIHT
GEKPYKCSECGKVFSQTSSLAIHRRIHTGEKPYKCNECGKAFSSHSNLNTHQIIHRGEKP
YKCNDCGKVFTQNSHLVNHQRIHTGEKPYKCNVCGKAFSVYASLTTHQVIHSGEKPYKCN
ECGKVFTQNSHLASHRRIHTGEKPYKCNKCGKAFSVSSSLTTHQLVHTGEKPYTCNECGK
VFGRRSNLASHQRIHTGLLKAYK
Download sequence
Identical sequences G1T405
ENSOCUP00000010977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]