SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011035 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011035
Domain Number 1 Region: 314-379
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000108
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 2 Region: 97-120
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000301
Family CCCH zinc finger 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000011035
Domain Number - Region: 247-271
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000144
Family CCCH zinc finger 0.0046
Further Details:      
 
Domain Number - Region: 404-432
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000366
Family CCCH zinc finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011035   Gene: ENSOCUG00000012822   Transcript: ENSOCUT00000012823
Sequence length 515
Comment pep:known_by_projection chromosome:OryCun2.0:17:81808026:81809573:-1 gene:ENSOCUG00000012822 transcript:ENSOCUT00000012823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPAAPSGAQEASGAQAGAEAAGEGASGPSLPECETSGESVAPDTAPARAALGLVPLRV
APSPAHLRMVGLRHVQAARGGARPSHLPSRSTGSWTKQVVCRYYLHGLCKEGENCRYSHD
LSGRQVAREGHGAPPRASADRGPSMAAPSQPPTQEVAEAAPAASSSSLPLIGSAAERGRF
EAELECAGQGAVGGSGVEGWEEAVEFVPGQPYRGRRVASVPEAPLQSSVTEREQMAVGMG
QQMAVGMGMQLCPHAARGQCFRGESCMYLHGEICDMCGLQALHPLDAAQRADHRKACVEA
HEKDMELSFAVQRSMDKVCGICMEVVYDKVNPSDRRFGILSNCNHPFCLKCIRRWRRARH
FENRIVKSCPQCRVTSNFVIPSEFWVEEEEEKQRLIQQYKEALSNKPCRYFAEGRGHCPF
GEHCFYKHSYPEGQGEEPQGRGGGPSAAYWHQLSQPVQLGEGSLLFKSSKKELVTLRLAS
LLFKRFLSLRNEFPFSEEQWDLLHYQLEEYFNLNL
Download sequence
Identical sequences G1T456
ENSOCUP00000011035 ENSOCUP00000011035 XP_002718332.1.1745 9986.ENSOCUP00000011035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]