SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011833 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011833
Domain Number 1 Region: 281-528
Classification Level Classification E-value
Superfamily SIS domain 6.92e-20
Family mono-SIS domain 0.0059
Further Details:      
 
Domain Number 2 Region: 29-280
Classification Level Classification E-value
Superfamily SIS domain 0.00000000635
Family mono-SIS domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011833   Gene: ENSOCUG00000013748   Transcript: ENSOCUT00000013754
Sequence length 622
Comment pep:known_by_projection chromosome:OryCun2.0:2:158578950:158598892:-1 gene:ENSOCUG00000013748 transcript:ENSOCUT00000013754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRFQHVIETPEPGEWELSGYEAAVPITEKSNPLTRDLDKADAERIVQLLGQCDAEI
FQEEGQVVPTYQRLYSESVLTTMAQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVS
FNQLMRGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISV
GLSAPFVAGQMDYCMDNTAVFLPVLVGFNPVSMARNDPIEDWSSTFRQIAERMQKMQERQ
EAFVLNPAVGPEGLSGSSRMKGGSATKVLLETLLLAAHKTVDRGIAASPKCLLEILRTFE
RAHQVTYSQSPKIAALMKQVSSSLKKKGRVHLVGWQTLGIIAIMDGVECIHTFGADFRDI
RGFLMGDHSDMFNQKAELTNQGPQFTFSQEDFQTSILPSLTEIDTVVFIFTLDDNLAEVQ
TLVEQVKEKTSNIQALAHSTVGQSLPSPLKKLFPSIISITWPLLFFEYEGNFVQKFQREL
STKWVLNTVSTGAHVLLGKILQNHMLEIRISNSKLFWRALAMLQRFSGQSKARCIESLLQ
AIHFPQPLSDDIRAAPISRHIEVAHCKDQVIPVALLSLLFRCSIPEAQAHLAAASSVCEA
VRSALTGPGRKRSADPQEPAVQ
Download sequence
Identical sequences G1T623
XP_002709846.1.1745 ENSOCUP00000011833 ENSOCUP00000011833 9986.ENSOCUP00000011833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]