SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011924 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011924
Domain Number 1 Region: 552-622
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.89e-17
Family SAM (sterile alpha motif) domain 0.00087
Further Details:      
 
Domain Number 2 Region: 1083-1152
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000482
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Domain Number 3 Region: 474-571
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000761
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011924   Gene: ENSOCUG00000013851   Transcript: ENSOCUT00000013862
Sequence length 1160
Comment pep:known_by_projection chromosome:OryCun2.0:12:139639198:139786026:1 gene:ENSOCUG00000013851 transcript:ENSOCUT00000013862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELRKRRVSQDLDVEKPDASSTSLQLRSQIEESLGFSSAVSTPEVERKHPLHKSNSEDS
SVGKGDWKKKNKYFWQNFRKNQKGVMRQTSKGEDVGYVASEITMSDEERIQLMMMVKEKM
ITIEEALARLKEYEAQHRQPAPLDPADWPDVSYPSFDGSSNCNSREQSDDETEESVKFKR
LHKLVNSTRRVRKKLIRVEEMKKPSTEGGEEHVFEPPPAPDERSALYSGVHKKPFFFDGA
PEKPPEGDSDSVTTSPSPSSSSLDTWGAGRKLAKTFSKGESRGLIKPPKKMGTFFSYPEE
EKAQKVSRSLTEGEMKKGLGSLSHGRTCSFGGFDLTNRSLHIGSNNADAMGKEGDFVYKE
VIKSPTASRISLGKKVKSVKETMRKRMSKKYSSSSVSEQDSALDGTPGSPVSPQPDSEHL
DKPKLKAGGSVESLRSSLSGQSSMSGQTVSTTDSSTSNRESVKSEDGDDEELPYRGPFCG
RARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLNEDE
EKPKRPTRRRRKGRPPQPKSVEDLLDRINLKEHMPTFLFNGYEDLDTFKLLEEEDLDELN
IRDPEHRAVLLTAVELLQEYDSNSDQSGSQEKLLVDSQGLPGCSPRDSGCYESSENLENG
KTRKSGLLPVKPAAEAGLKAFSRSPRGNYPTLPLTKPADPQERAEKEGRLGWGPTLDAPG
GCAPPRLPGASRNRRSLPVSICRSFETLEGPQAVDAWPRSHSLDDLQGGPGVGKDAPAEG
PAAAPRIAPEVPQKTAAPAAKLLHPERDSAARTALLLTQSKRFSEPQRATAKRLEGWAAA
PARGSSLPPCVPRNCDAQPPGAPHGLSRTSLEGHGKGQDFEGTNHPPGPKEGLDAEQRVP
EARAPPKHPPQPPPVPAKKSRERLANGLHPGPSPDAPCLPAKKGSLPSPAGPGDGPSPGQ
EPGSPRSTRPPPWLSELPESASLQEHGVRLGSALSRKVSCPRGADLETLAENKLHAEGID
LTEEPYSDKHGRCGIPEALVQRYAEDLDQPEREVATHLDQIRVKLLRKQHRMAIPSGGLT
EICRKPLSPGCIASVSDWLISIGLPMYTSTLADAGFSTLSQVPSLSHTCLQEAGITEERH
IRKLVSAARLFKLPAGPEAV
Download sequence
Identical sequences G1T699
XP_008261849.1.1745 ENSOCUP00000011924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]