SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012738 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012738
Domain Number 1 Region: 372-463
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.62e-40
Family Small-conductance potassium channel 0.0000026
Further Details:      
 
Domain Number 2 Region: 241-412
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.46e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012738   Gene: ENSOCUG00000014818   Transcript: ENSOCUT00000014816
Sequence length 556
Comment pep:known_by_projection scaffold:OryCun2.0:GL019132:18167:121162:1 gene:ENSOCUG00000014818 transcript:ENSOCUT00000014816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPAPGAGGASSPCAAAAASSPAPEI
VVSKPEHNNSNNLALYGAGGGGGPKPSKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGM
FGIVVMVIETELSWGAYDKASLYSLALKCLISLSTVILLGLIIVYHAREIQLFMVDNGAD
DWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMF
LRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWI
IAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGA
GCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKI
DHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDF
EKRIVTLETKLETLIGSIQALPGLLSQTLRQQQRDFLEAQLEARDKHGPYEAARSRSSSR
RRRSSSTAPPTSSESS
Download sequence
Identical sequences G1T862
ENSOCUP00000012738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]