SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013421 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013421
Domain Number 1 Region: 74-134
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.29e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 247-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 413-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000161
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 209-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000173
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 5 Region: 452-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000631
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013421   Gene: ENSOCUG00000015627   Transcript: ENSOCUT00000015623
Sequence length 550
Comment pep:known_by_projection chromosome:OryCun2.0:12:21999294:22033322:-1 gene:ENSOCUG00000015627 transcript:ENSOCUT00000015623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFSVEHLLKLVGTAAFSPLFLVSIQYIPSLLYFAVAGFVSSLPSMVYLSWICSSLRARS
QPLCVCRLPESLLLFQRPVTFEDVAVDFTQDEWDYLDDSQRALYQDVMSETCKNLASVAR
IFLTKPNVIAKCEPKEAPWRAAVRPPDNEVLSGGKKEELQEQGQSLRDEGTGDDKVSLAC
RGTRRSPPSAPAGSTDRTPVLQASQTGPPFSCLTCGRCFSKSSYLYSHQFVHSPKRTNSC
SQCGKLFRSPKALSYHRRMHLGERPFCCPLCDKTYCDASGLSRHRRVHLGYRPHSCPVCG
KRFRDKSELKRHQKIHQNQELLVRTLDTMAGLQAPIDGSLGLVDTDHAPGTRAQQPEFRT
QDPMTRNQVMTGRNQTTVIRTPGPVSRTEAPYTSGPCLDTRSNSLPMKSSRLKIFICPHC
PLTFTKKAYLSRHQQVHFREQPSRCFHCGKCFGSVSRLVEHQQVHWTQKIYRCPVCDLCF
GDKEGLLGHWKNYKGKELGNAPKCWAVLGQWLDFLHDASPMAGKDQKHGGSGSPRIQILR
RGKVRKEVSK
Download sequence
Identical sequences G1T9U8
ENSOCUP00000013421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]