SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013473 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013473
Domain Number 1 Region: 1124-1302
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.08e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00089
Further Details:      
 
Domain Number 2 Region: 687-802
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.83e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0018
Further Details:      
 
Domain Number 3 Region: 454-575
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-24
Family Pleckstrin-homology domain (PH domain) 0.0000113
Further Details:      
 
Domain Number 4 Region: 922-1039
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-21
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 5 Region: 1436-1569
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-21
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 
Domain Number 6 Region: 584-686
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-16
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 7 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.14e-16
Family SAM (sterile alpha motif) domain 0.0000393
Further Details:      
 
Domain Number 8 Region: 1016-1116
Classification Level Classification E-value
Superfamily PH domain-like 0.000000402
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013473   Gene: ENSOCUG00000015669   Transcript: ENSOCUT00000015685
Sequence length 1709
Comment pep:known_by_projection chromosome:OryCun2.0:2:25719210:25915076:-1 gene:ENSOCUG00000015669 transcript:ENSOCUT00000015685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSEINVDIKDFLMSINLEQYLLHFHKFGFYTVKDCTTINDTVLHKIGISPTGHRRRI
LKQLQIILSKMQDIPIYANIHKTKKNDDTSKDCHAPPSDRNTCREISNSDSTHKPSSTQL
EAVTQSLHQNDNGMEHSQSLKSDDKLSLPKRDFPVPDQEPRLNLGSSHDSSFGSENIKIE
SLIAKKTVDCTIEQQTEKVDSILETISKLPSIDPECLSSLGSSTSDANSVNGSNGLVEAS
PPSPFFQFQGEMVVNDLYIPSSPNLAPMRSRSKLVSRPSRSFLLRHRPVPEIPASTKGIS
GSYFRERRNVATSPGKSAAWQKDSSEEISSSIFPYGETFLFQRLENSKKRCVKNEFWAHE
ETLKGEANTAGNSFCIKSSIYDNRKEKISEEKVEDIWIPREDKNNLMIESASESEYSTVE
ECFQSLRRKNSKASRLRTQKALSLDPVNRHSYPLSSTSGNADSSGISSNAISPYACFYGT
SAKKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEREMYSKGIIPLSAISTVRVQG
DNKFEVVTTQRTFVFRVEKEEERNDWISILLNALKTQSLTSQSQVVAAPEKCGYLELRGY
KAKIFTVLRGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSF
TAESEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCQAPDPDWASINLCVVI
CKKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIIIGNKRANDFWAGNLQKDEELHM
DSPVEKRKSFIIQKYKEGKFRKTLLASLTKEELNKALCAAVVTPDVLETMALLFSGADVM
CATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGGLSQEASQSTFLCDFL
YQAPAAASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTPNGTININEVICLAIHKED
FYLNTGPIFVFEIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPFVAENLTETDYDLIGQ
LFYKDCHALDQWKKGWFAMDKFNLRFCLQMQEVQEDRMHLRRLQELTISTMVQNGEKLDV
LLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVT
QYDKGLGCKYIYQKNGDPLHISELLENFKKDARSFKLRAGKHQLEDVTSVLKRFLSDIDD
ALLAKELYPYWISALDTQDDKERIKKYGAFIRTLPVVNQATLAAIIEHLYRVQKCSEINH
MNAHNLALAFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWK
DTQVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKSDVWATFE
VIENEELERPLHYRENVLEQVLRWSSLAEPGSACLVVKRFLTVDTIEHCRERRALESIKE
GVLKIKEEPSKILSGNKFQDRYFVLRDGCLFIYKDSKSSKHEKMFSLSSMKFYLGVKKKM
KPPTSWGLTAYSDKHHWHLCCDSSQTQIEWMASIFIAQHENDIWPPAGQERKRSITKNPK
IGGLPLIPIQQERNTIQARKNIESARAELERLWLSEKRDREPVDSTLRDRASMVAHCLEH
KDDRFRNRTRKHRSLNCLEDTETEVPGQPKGLKGMKTLRKTEEKTSKAPVDSDHKLPSKV
IEELSVVLQRSRTLPKQLQDEHMMQKEIK
Download sequence
Identical sequences G1T9Z6
ENSOCUP00000013473 ENSOCUP00000013473 9986.ENSOCUP00000013473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]