SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013597 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013597
Domain Number 1 Region: 236-304
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.07e-17
Family SAM (sterile alpha motif) domain 0.00011
Further Details:      
 
Domain Number 2 Region: 162-239
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000433
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013597   Gene: ENSOCUG00000015833   Transcript: ENSOCUT00000015832
Sequence length 373
Comment pep:known_by_projection chromosome:OryCun2.0:14:142370848:142409806:-1 gene:ENSOCUG00000015833 transcript:ENSOCUT00000015832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELFSKPVNETDPEFSLKAQRSSSFGNFDRFRHNSVSKPNNSTEIYVMDILDKSNENKMTA
LSNLSKYGKHLRCFQGNLNSTIKNVLRKVSKYRDEEDGEDTLPYRNSDPVIGTHTEKISL
KASDSLDSLYSGRSSSSGITSCSDGTSNRDSFRLDDDSPYSGPFCGRARVHTDFTPSPYD
NDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEEAPRKIKAHRRSRS
GKPETLPEFLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIESSEDRMRFLSAAE
NLLDEETIQEQENDSVPLSSSPDISLNKSQLDNCPRDSGCYISSGNSDNGKEDLESENLP
DMVQKISISEPSV
Download sequence
Identical sequences G1TAA9
ENSOCUP00000013597 9986.ENSOCUP00000013597 ENSOCUP00000013597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]