SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014089 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014089
Domain Number 1 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 5 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.8e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 508-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 200-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014089   Gene: ENSOCUG00000016395   Transcript: ENSOCUT00000016392
Sequence length 565
Comment pep:known_by_projection scaffold:OryCun2.0:GL018730:324516:345570:-1 gene:ENSOCUG00000016395 transcript:ENSOCUT00000016392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRLLSAQVQGSVTFRDVAVFFSQDEWLHLDSAQRRLYREVMLENYSNLLSLGILFSKP
KVISQLEQADHWLVKKEVPRGTRLGWESLFATTVPEEKNQEVMKKLTNGPFDFMLRNSYI
NDNRFEKQQGKKNTLFRKALVTVKKTYLRERNFKGTELGKNLDLKSSLTRKPGIVSRGRK
ARSQQYSILFKQLGVNTVRKCYKCNICGKIFLHSSSLSKHQRIHTGEKLYKCKECRKAFS
QSSSLTQHLRVHTGEKPYICRECGKAFSFTTSLIGHQRMHTGERPYKCEECGKTFKGSSS
LNNHQRIHTGEKPYKCNECGRAFSQCSSLIQHHRIHTGEKPYECGQCGKAFTSISRLSRH
HRIHTGEKPFHCNECDKVFSYHSALIIHQRTHTGEKPYACKECGKAFSQSSALIQHQRIH
TGEKPYKCNECGKAFSWISRLNIHHRIHTGEKPYSCKECGKAFSSHSAVNTHRKIHTGEK
PYKCNDCEKAFNQSSALIQHQRIHTGEKPFHCEVCGKAFRQSSSLMTHLRIHTGEKPYKC
KECGKAFSQSSSLTNHQRTHTREEL
Download sequence
Identical sequences G1TBJ1
ENSOCUP00000014089 XP_008273172.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]