SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014294 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014294
Domain Number 1 Region: 480-583
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 2 Region: 69-173
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 3 Region: 198-301
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000082
Further Details:      
 
Domain Number 4 Region: 354-458
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014294   Gene: ENSOCUG00000016629   Transcript: ENSOCUT00000016626
Sequence length 584
Comment pep:known_by_projection chromosome:OryCun2.0:6:26675671:26688798:1 gene:ENSOCUG00000016629 transcript:ENSOCUT00000016626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPPAGWTHGDAEARMGPQLDERTPAWRPGDGGAAPSPLPPALSFLLLLPLASALQPTPL
PFPACFSAELRLVGGPSRCRGRLEVLHDGSWGSVCDDDWDVVDANVVCRQLGCGLALPVP
RPLAFGQGRGPILLDNVECRGQEAALSECGSRGWGVHNCFHYEDVAVLCEEFLPSQYATR
RALTSSAPPPSLQNGRDEGSVRLAGGAGPCQGRVEILHAGVWGTVCDDDWGLPDAAVVCR
QLGCGAALAATTNAFFGYGTGHILLDNVHCEGVEPQLAGCSSLGWGVHNCGHHEDAGVFC
AVLDPATPTAPPPSATRDDSAWHTERAATRGGAQPSGETASLTTAAWAAGRKSGRLRLVG
GPGPCRGRVEVLYAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLL
DNVGCTGTEARLSDCFHLGWGQHNCGHHEDAGALCAGPDELVQQEGSETTRVPTPRPRDG
HLRLANGAHRCEGRVELFLGQQWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPG
RGPILLDNVKCRGDESTLLLCSHIRWDAHNCDHGEDAGVLCRPL
Download sequence
Identical sequences G1TC14
XP_008256200.1.1745 XP_008256201.1.1745 ENSOCUP00000014294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]