SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015226 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015226
Domain Number 1 Region: 155-319
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-41
Family Dual specificity phosphatase-like 0.000017
Further Details:      
 
Domain Number 2 Region: 330-463
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.23e-37
Family PLC-like (P variant) 0.002
Further Details:      
 
Domain Number 3 Region: 14-144
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000581
Family Voltage-gated potassium channels 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015226   Gene: ENSOCUG00000023872   Transcript: ENSOCUT00000017729
Sequence length 464
Comment pep:novel scaffold:OryCun2.0:GL018705:2198857:2249944:-1 gene:ENSOCUG00000023872 transcript:ENSOCUT00000017729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRIKNIARLIVSSFAFRIFGILLIFVDIFLIVSDVLFNDNTMVLEFRSTSLAIAFFFLFD
VLLRIYVEGRKQYFSDLFNTLDTVIIAITLVIDTIYFFFDLRILKDIPRLAVLLRPLRLL
ILVRVFHLAYQKRQLEKLTRRLVSGNKRRYNRDGFDLDLTYVTDRIIAMSFPSSGKQSFY
RNPIKEVVRFLDTKHPNHYRVYNLCSEKAYDPEYFHNRVQRIMIDDHNVPTLSEMVVFAK
EVNMWLAQDKENVVVIHCKGGKGRTGTMVCVCLIANQLFGTAEDSLSFFGHRRTDQTTST
KYQGVETPSQHRYVGYFEKVKRLHHWTLPPRKILQPNKIIIHSIHSVGKGDGSDLKIQII
TMQQTVFSCSSSKNCKIFHDIETDRVIFELLNCPILYDDVKVRFLSRNLPKYYDKCAFFF
WFNTAFIQNNRLYLRRNELDNPHKRKAWKIYGPCFAVEIYFNTT
Download sequence
Identical sequences G1TEB2
ENSOCUP00000015226 9986.ENSOCUP00000015226 ENSOCUP00000015226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]