SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015868 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015868
Domain Number 1 Region: 291-405
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-33
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 2 Region: 135-244
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-33
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 3 Region: 455-567
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.59e-28
Family Frizzled cysteine-rich domain 0.0003
Further Details:      
 
Domain Number 4 Region: 248-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000109
Family LDL receptor-like module 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000015868
Domain Number - Region: 411-443
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015868   Gene: ENSOCUG00000027014   Transcript: ENSOCUT00000025678
Sequence length 570
Comment pep:novel scaffold:OryCun2.0:GL018823:796902:801628:-1 gene:ENSOCUG00000027014 transcript:ENSOCUT00000025678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEHSEEVSLCVEATEQSKTEFCNPAFEPEAEPPCPAPAFQGEAPCSSPAPWHGRRPRGL
QPDCRFSWLCVLLLAGLLLLLLGLLVAVILAQLQAAPPPGATYGPLPARGPASPAPGLPG
RPQQAGVSPTPHPTCGGLLPGPRGFFSSPNYPDPYPPNAHCVWHIQVATDHTIQLKIEAL
SMESVASCLFDRLEISPEPEGPLLRVCGRVAPPTLNTNASRLRVAFVSDSSVEGSGFQAW
YQAVVPGHGSCAHDEFSCDQLTCLLPDSVCDGFANCADGSDETNCSAKSSGCGGHLTGLQ
GAFSTPSYLQQYPHHQLCTWRISVPAGLGIELQFHNFSLEAQDECKVAYVEVYETSSSGA
LSLLGRFCGTEPPPRLLSSHRELAVFFRTDHGVSGGGFSATFQAFNATDNPCGRRKSSCL
DGECKGLQWVCDMWRDCTGGSGDNCSSPLAPPPELACEPVQVEMCVGLSYNTTAFPNIWV
GMATQQEVVEVLRGYKSLTSLPCYQSFRRLLCGLLVPRCTPLGSVLPPCRSVCQEAERQC
QSGLALLGTPWPFNCNRLPEAAGLEACAQP
Download sequence
Identical sequences G1TG20
9986.ENSOCUP00000015868 ENSOCUP00000015868 ENSOCUP00000015868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]